PDBID: | 9ibb | Status: | HPUB -- hold until publication | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | Deposition date: | 2025-02-12 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
PDBID: | 9na1 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|
PDBID: | 9na7 | Status: | HPUB -- hold until publication | Title: | RNA scaffold | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | Deposition date: | 2025-02-11 |
|
PDBID: | 9iax | Status: | HPUB -- hold until publication | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | Authors: | Chaplin, A.K., Hall, C. | Deposition date: | 2025-02-11 |
|
PDBID: | 9iat | Status: | HPUB -- hold until publication | Title: | Bc8.121 Fab | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | Deposition date: | 2025-02-11 |
|
PDBID: | 9lut | Status: | HPUB -- hold until publication | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | Deposition date: | 2025-02-10 |
|
PDBID: | 9luu | Status: | HPUB -- hold until publication | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | Deposition date: | 2025-02-10 |
|
PDBID: | 9luw | Status: | HPUB -- hold until publication | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | Authors: | Gu, C.K., Wang, S.J. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n97 | Status: | HPUB -- hold until publication | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n8z | Status: | HPUB -- hold until publication | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | Authors: | Marx, D.C., Levitz, J.T. | Deposition date: | 2025-02-10 |
|
PDBID: | 9n8y | Status: | HPUB -- hold until publication | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | Authors: | Marx, D.C., Levitz, J.T. | Deposition date: | 2025-02-10 |
|
PDBID: | 9lui | Status: | AUTH -- processed, waiting for author review and approval | Title: | structure of PSP2 | Authors: | Qi, C., Gu, T.N., Li, X.M. | Deposition date: | 2025-02-08 |
|
PDBID: | 9ia3 | Status: | HPUB -- hold until publication | Title: | Bc8.108 Fab bound to preS2 peptide | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | Deposition date: | 2025-02-07 |
|
PDBID: | 9ltx | Status: | HPUB -- hold until publication | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | Deposition date: | 2025-02-06 |
|
PDBID: | 9ltg | Status: | HPUB -- hold until publication | Title: | Crystal structure of H-2Kb with C.parvum peptide | Authors: | Fan, S.H., Wang, Y.L. | Deposition date: | 2025-02-06 |
|
PDBID: | 9ltf | Status: | HPUB -- hold until publication | Title: | Crystal structure of mSTING-TTB | Authors: | Zhang, C.G., Hou, Y.F., Liu, P.Y., Fan, S.L. | Deposition date: | 2025-02-06 |
|
PDBID: | 9ltd | Status: | HPUB -- hold until publication | Title: | Human PKM2 complex with serine | Authors: | Wang, J., Wu, C. | Deposition date: | 2025-02-06 |
|
PDBID: | 9lte | Status: | HPUB -- hold until publication | Title: | Human PKM2 complex with methionine | Authors: | Wang, J., Wu, C. | Deposition date: | 2025-02-06 |
|
PDBID: | 9n7n | Status: | HPUB -- hold until publication | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | Authors: | Han, Z., Mirkin, C.A. | Deposition date: | 2025-02-06 |
|
PDBID: | 9n7u | Status: | HPUB -- hold until publication | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | Authors: | Han, Z., Mirkin, C.A. | Deposition date: | 2025-02-06 |
|
PDBID: | 9i9d | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CP of RHDV virion (full particle) | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | Deposition date: | 2025-02-06 |
|
PDBID: | 9i9h | Status: | HPUB -- hold until publication | Title: | Structure of FAB-fragment GB11 in complex with Sialyl Lewis A | Authors: | Freitag, A., Khan-Kilji, S., Nedielkov, R., Murali Kumar, S., Krummhaar, M., Luehle, J., Goerdeler, F., Arndt, J., Kamphues, C., Mroginski, M.A., Roth, C., Seeberger, P.H., Moeller, H.M., Moscovitz, O. | Deposition date: | 2025-02-06 |
|
PDBID: | 9i9a | Status: | HPUB -- hold until publication | Title: | COLLAGEN-LIKE (PRO-PRO-GLY)10 AT 0.86 GPa HYDROSTATIC PRESSURE | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | Deposition date: | 2025-02-06 | Sequence: | >Entity 1 PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2 PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
PDBID: | 9i90 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CP of empty RHDV virion | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | Deposition date: | 2025-02-06 |
|
PDBID: | 9i9l | Status: | HPUB -- hold until publication | Title: | Structure of Far-Red Photosystem I from C. thermalis PCC 7203 | Authors: | Consoli, G., Tufaill, F., Murray, J.W., Fantuzzi, A., Rutherford, A.W. | Deposition date: | 2025-02-06 |
|