| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iat | | Status: | HPUB -- hold until publication | | Title: | Bc8.121 Fab | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9luu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luw | | Status: | HPUB -- hold until publication | | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | | Authors: | Gu, C.K., Wang, S.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lut | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8y | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8z | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of PSP2 | | Authors: | Qi, C., Gu, T.N., Li, X.M. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9ia3 | | Status: | HPUB -- hold until publication | | Title: | Bc8.108 Fab bound to preS2 peptide | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9l | | Status: | HPUB -- hold until publication | | Title: | Structure of Far-Red Photosystem I from C. thermalis PCC 7203 | | Authors: | Consoli, G., Tufaill, F., Murray, J.W., Fantuzzi, A., Rutherford, A.W. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H-2Kb with C.parvum peptide | | Authors: | Fan, S.H., Wang, Y.L. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mSTING-TTB | | Authors: | Zhang, C.G., Hou, Y.F., Liu, P.Y., Fan, S.L. | | Deposition date: | 2025-02-06 |
|
