| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2025-01-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8uth | | Status: | HPUB -- hold until publication | | Title: | Active site binding triggers E1-rearrangements revealing E1-E2 lipoyl domain interactions in the Pyruvate dehydrogenase complex | | Authors: | Arjunan, P., Whitley, M., Furey, W. | | Deposition date: | 2023-10-31 | | Release date: | 2025-04-30 |
|
| PDBID: | 8utj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-16 |
|
| PDBID: | 8wyq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 8wyk | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (2 mM EGTA, closed state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wyl | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wym | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, pre-open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wyn | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (5 mM Ca2+, closed state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wyh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The global map of Omicron Subvariants Spike with ACE2 | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-11-07 |
|
| PDBID: | 8wyj | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The global map of Omicron Subvariants Spike with two antibodies | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-11-07 |
|
| PDBID: | 8wyo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-01 |
|
| PDBID: | 8wyv | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A D170N/S176V/C240S/C393S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-31 | | Release date: | 2024-12-01 |
|
| PDBID: | 8r00 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human PXR ligand-binding domain in complex with furanodienone | | Authors: | Bourguet, W., Carivenc, C., Sirounian, S. | | Deposition date: | 2023-10-30 | | Release date: | 2025-04-30 |
|
| PDBID: | 8r01 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-30 | | Release date: | 2025-04-30 |
|
| PDBID: | 8usz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 | | Release date: | 2025-04-29 |
|
| PDBID: | 8utc | | Status: | HPUB -- hold until publication | | Title: | HUMAN LEUKOCYTE ANTIGEN B*07:02 IN COMPLEX WITH SARS-COV2 EPITOPE N105-113 (Y111F mutant) | | Authors: | Oltean, N., Nyovanie, S., Hashem, A., Patskovska, L., Patskovsky, Y., Krogsgaard, M. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8usv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 | | Release date: | 2025-04-30 |
|
| PDBID: | 8utd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 | | Release date: | 2025-04-27 |
|
| PDBID: | 8usy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wy2 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A S176V/C240S/C393S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-30 | | Release date: | 2024-11-30 |
|
| PDBID: | 8wxg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human CLC-1 | | Authors: | Zhang, M.F. | | Deposition date: | 2023-10-29 | | Release date: | 2024-10-29 |
|
| PDBID: | 8wxh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human CLC-1 T268M | | Authors: | Zhang, M.F. | | Deposition date: | 2023-10-29 | | Release date: | 2024-10-29 |
|
| PDBID: | 8wxi | | Status: | HOLD -- hold until a certain date | | Title: | human CLC-1 D136G delayed rectification | | Authors: | Zhang, M.F. | | Deposition date: | 2023-10-29 | | Release date: | 2024-10-29 |
|
