| PDBID: | 9koc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor ensitrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9koa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor simnotrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9ko7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chicken ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hge | | Status: | HPUB -- hold until publication | | Title: | PB1 domain of p62/SQSTM1 | | Authors: | Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, UTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ees | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in an expanded state complexed with CP, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | HPUB -- hold until publication | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
SMSLAATAWQRLEALFHRACQLPAAEREAFARAQAGDDASLRDDLLAMLAVESQATLRVRAPLKQAVAALRAPLPELPAGTRFGAWAIDRLIGAGGMGQVYLGHRADGAYEREVAIKLVAADALDAQGRALFEFECRLLAQMVHPAIAQIHDVGTDAHGQPYLVAEYLRGEPITWWCDEHRLSLHARVLLMLRVGEAVQHAHQKGVIHRDLKPSNVLVSEIDGRPMPGVIDFGIAVDATNPGMTYAHDRGTPGYMSPEQARGAQDVDARSDIYALGAMFYELSCGLAPVAGRDGVPQPPSQRVAAVPADARARICAARATTYQKLHEQLRDGLDAIVLRALEPQPGARYASVSALLDDLHRWLD
|
|
| PDBID: | 9ef4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with two DILP1, symmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP2, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with three DILP5, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9kn2 | | Status: | HPUB -- hold until publication | | Title: | Crystallization of zinc metalloproteinase PepO from Porphyromonas gingivalis | | Authors: | Feng, C.Y., Feng, C.Y. | | Deposition date: | 2024-11-18 | | Sequence: | >Entity 1
NKGQTNDTDRKREPVPAIDLSAMDTSVRPQDDFYRYCNGNWMKNNPLKPAYSRYGSFDILHDSTLERVHLIVDNLAAGQHEVGTNEYRIATLYRQAMDSIKRNKDGAAPLKEDLQKIEAIADRAAMVKYAAAKDNMGGSTFFGSYVYADAKNSEMNIFHITQTGLALDNRDYYLKQDAKSQQIREAYVAYLNKIAKLAGYDDEAATRIAKNAMKMETELAQICYSKEELRDTHRNYNKMAVKEFTNKYQGFDWTTYLADRQLTTLEEWDVEQLDFFKKFDSWFAKADLNEMRDYLLAGTISGAASYLSDDFEQARFDFFGKTLSGTTEMHPRWKRSVGMVSSFLGEALGEVYVKQYFPPEAKERMLKLVKNLQTALGERINMLTWMGDSTKMKAQEKLNSFIIKIGYPDKWKDYSKMEIKGDSYYADIKRASKWMHDDNMADLGKTVDRERWLMNPQDVNAYYNPTTNEICFPAAILQPPFFNMDADDAVNYGGIGVVIGHEMTHGFDDQGRNFDKDGNMINWWTAEDAQKFETTARKLADQFSEIYVADGVRANGNMTLGENIADQGGLLISYLAFRNAAKGEVMEEIDGFTPDQRFFIGYARLWGQNIRPEEVLRLTQIDVHSLGELRVNQALRNIEAFYEAFNIQPTDKMYLEPEKRVVVW
|
|
| PDBID: | 9edr | | Status: | HPUB -- hold until publication | | Title: | Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin | | Authors: | Taheri, A., Al-bassam, J. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9kly | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22032 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9km1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22077 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9ecv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM Structure Of Respiratory Syncytial Virus Polymerase in complex with Novel Non-Nucleoside Inhibitor Compound 16 | | Authors: | Yin, Y., Tran, M.T., Yu, X., Jonckers, T., Carney, C. | | Deposition date: | 2024-11-15 |
|
| PDBID: | 9heq | | Status: | HPUB -- hold until publication | | Title: | Open-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hep | | Status: | HPUB -- hold until publication | | Title: | Primed-state RyR1 in 0.05% POPC micelles, in complex with a nanobody and FKBP | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
