Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8re5
Status:HPUB -- hold until publication
Title:Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735Q variant in complex with Mn, 2-oxosuberate and a Factor X derived peptide fragment
Authors:Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J.
Deposition date:2023-12-10
PDBID:8re7
Status:HPUB -- hold until publication
Title:Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735W variant in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment
Authors:Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J.
Deposition date:2023-12-10
PDBID:8re6
Status:HPUB -- hold until publication
Title:Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735Q variant in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment
Authors:Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J.
Deposition date:2023-12-10
PDBID:8re9
Status:HPUB -- hold until publication
Title:Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment
Authors:Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J.
Deposition date:2023-12-10
PDBID:8re8
Status:HPUB -- hold until publication
Title:Aspartyl/Asparaginyl beta-hydroxylase (AspH) R688Q variant in complex with Mn, (3R)-methyl-2-oxoglutarate and a Factor X derived peptide fragment
Authors:Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J.
Deposition date:2023-12-10
PDBID:8xc7
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of LL-D49194-alpha-1 covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2
Authors:Gao, R.Q., Tang, G.L., Cao, C.
Deposition date:2023-12-08
Release date:2024-12-08
PDBID:8rcx
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir
Authors:Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R.
Deposition date:2023-12-07
PDBID:8rdb
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase N252E variant in complex with Fe and ACV under anaerobic conditions
Authors:Stead, A., Rabe, P., Schofield, C.J.
Deposition date:2023-12-07
PDBID:8rdc
Status:HPUB -- hold until publication
Title:Galectin-1 in complex with thiogalactoside derivative
Authors:Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U.
Deposition date:2023-12-07
PDBID:8v94
Status:HPUB -- hold until publication
Title:De novo designed homo-oligomeric TM domain aITL_04927
Authors:Mravic, M., Anderson, C.T.
Deposition date:2023-12-07
PDBID:8rci
Status:HPUB -- hold until publication
Title:Human p53 DNA-binding domain bound to DARPin C10
Authors:Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC)
Deposition date:2023-12-06
PDBID:8v8f
Status:HPUB -- hold until publication
Title:The co-crystal structure of anti-HIV scFv and Utag.
Authors:Chen, S.H., Snow, C.D.
Deposition date:2023-12-05
PDBID:8xao
Status:HPUB -- hold until publication
Title:The thermostable and acid-tolerant DNA-binding protein
Authors:Chen, C.Y., Huang, C.H.
Deposition date:2023-12-05
PDBID:8xap
Status:HPUB -- hold until publication
Title:Thermostable and acid-tolerant DNA-binding protein
Authors:Chen, C.Y., Huang, C.H.
Deposition date:2023-12-05
PDBID:8xaq
Status:HPUB -- hold until publication
Title:The thermostable and acid-tolerant DNA-binding protein
Authors:Chen, C.Y., Huang, C.H.
Deposition date:2023-12-05
PDBID:8rbf
Status:HPUB -- hold until publication
Title:CryoEM structure of the post-powerstroke actomyosin-5a complex
Authors:Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D.
Deposition date:2023-12-04
PDBID:8rbg
Status:HPUB -- hold until publication
Title:CryoEM structure of primed myosin-5a (ADP-Pi state)
Authors:Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D.
Deposition date:2023-12-04
PDBID:8xal
Status:HPUB -- hold until publication
Title:Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2
Authors:Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D.
Deposition date:2023-12-04
PDBID:8ray
Status:HPUB -- hold until publication
Title:ParA in complex with ATP
Authors:Mais, C.-N., Bange, G.
Deposition date:2023-12-01
PDBID:8v5u
Status:HPUB -- hold until publication
Title:Human SIRT3 bound to p53-AMC peptide and Honokiol
Authors:Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T.
Deposition date:2023-12-01
Sequence:

>Entity 1


SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

>Entity 2


QPK(FDL)
PDBID:8xa3
Status:AUTH -- processed, waiting for author review and approval
Title:C-hexon capsomer of the VZV B-Capsid
Authors:Nan, W., Lei, C., Xiangxi, W.
Deposition date:2023-12-01
PDBID:8xa2
Status:AUTH -- processed, waiting for author review and approval
Title:Penton capsomer of the VZV B-Capsid
Authors:Nan, W., Lei, C., Xiangxi, W.
Deposition date:2023-12-01
PDBID:8xa1
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Portal vertex capsomer of VZV B-capsid
Authors:Nan, W., Lei, C., Xiangxi, W.
Deposition date:2023-12-01
PDBID:8xa0
Status:AUTH -- processed, waiting for author review and approval
Title:penton capsomer of the VZV C-capsid
Authors:Nan, W., Lei, C., Xiangxi, W.
Deposition date:2023-12-01
PDBID:8x9z
Status:WAIT -- processing started, waiting for author input to continue processing
Title:P-hexon capsomer of the VZV C-Capsid
Authors:Nan, W., Lei, C., Xiangxi, W.
Deposition date:2023-12-01

225946

PDB entries from 2024-10-09

PDB statisticsPDBj update infoContact PDBjnumon