| PDBID: | 9awy | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length amyloidogenic immunoglobulin light chain H9 in complex with 3-(2-(4-(3-ethyl-3-phenylpyrrolidin-1-yl)-6-methyl-2-oxopyridin-1(2H)-yl)ethyl)-8-(imidazo[1,5-a]pyrazin-8-yl)-1,3,8-triazaspiro[4.5]decan-2-one | | Authors: | Lederberg, O.L., Kelly, J.W., Yan, N.L., Wilson, I.A., Stanfield, R.L. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9ax1 | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length amyloidogenic immunoglobulin light chain H9 in complex with 2-(6-methyl-2-oxo-4-(2-phenylpropoxy)pyridin-1(2H)-yl)ethyl (3-(1H-imidazol-4-yl)benzyl)carbamate | | Authors: | Lederberg, O.L., Yan, N.L., Stanfield, R.L., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8s7v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Methyl-coenzyme M reductase activation complex binding to the A2 component | | Authors: | Ramirez-Amador, F., Paul, S., Kumar, A., Schuller, J.M. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8s7x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Methyl-coenzyme M reductase activation complex without the A2 component | | Authors: | Ramirez-Amador, F., Paul, S., Kumar, A., Schuller, J.M. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8s7n | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151L mutant bound to eugenol | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7p | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7q | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151I mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7r | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151T mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7s | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151G mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7t | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151N mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7u | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151L mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7w | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151V mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a double mutant of VirB8-like OrfG central and C-terminal domains of Streptococcus thermophilus ICESt3 (Gram positive conjugative type IV secretion system). | | Authors: | Favier, F., Didierjean, C., Maffo-Woulefack, R., Douzi, B., Leblond-Bourget, N. | | Deposition date: | 2024-03-03 |
|
| PDBID: | 8yjh | | Status: | HPUB -- hold until publication | | Title: | endogenous state A PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 9auq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 4-Fluoro-tryptophan labeled Oscillatoria Agardhii agglutinin | | Authors: | Runge, B.R., Zadorozhnyi, R.R., Quinn, C.M., Russell, R.W., Lu, M., Antolinez, S., Struppe, J., Schwieters, C.D., Byeon, I.L., Hadden-Perilla, J., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s70 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Pseudomonas aeruginosa recombinase A (RecA) in complex with ssDNA 72mer and ATPgS | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Grinzato, A., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-02-28 |
|
