PDBID: | 9g6l | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 20C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-18 |
|
PDBID: | 9g6m | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 30C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-18 |
|
PDBID: | 9g6n | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 40C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-18 |
|
PDBID: | 9g6o | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 45C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-18 |
|
PDBID: | 9g6p | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 50C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-18 |
|
PDBID: | 9g5n | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 20C using serial fixed-target crystallography | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g5s | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 30C using serial fixed-target crystallography | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g5w | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 40C using serial fixed-target crystallography | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g5x | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 45C using serial fixed-target crystallography | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g61 | Status: | HPUB -- hold until publication | Title: | Xylose Isomerase collected at 50C using serial fixed-target crystallography | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g4f | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the proton-dependent antibacterial peptide transporter SbmA in complex with FabS11-1 in lipid nanodiscs at pH 5.5, inward-closed state | Authors: | Ghilarov, D., Beis, K. | Deposition date: | 2024-07-15 |
|
PDBID: | 9g4e | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the proton-dependent antibacterial peptide transporter SbmA in complex with FabS11-1 in lipid nanodiscs at pH 5.5, inward-open state | Authors: | Ghilarov, D., Beis, K. | Deposition date: | 2024-07-15 |
|
PDBID: | 9iqw | Status: | HOLD -- hold until a certain date | Title: | phage HY126 encoded D-arabinose 1,5-diphosphate phosphatase AfhF | Authors: | Yu, H., Lianrong, W. | Deposition date: | 2024-07-13 | Release date: | 2025-07-13 |
|
PDBID: | 9clz | Status: | HPUB -- hold until publication | Title: | Novel designed icosahedral nanoparticle I3-A6 | Authors: | Haas, C.M., Jasti, N., Dosey, A.M., Gillespie, R., Allen, J.D., Leaf, E.M., Crispin, M., DeForest, C., Kanekiyo, M., King, N.P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3w | Status: | HPUB -- hold until publication | Title: | Human Gamma-D crystallin R36S mutant with TNB-Cystein Protein modification | Authors: | Hill, J.A., Pulnova, Y., Yorke, B.A. | Deposition date: | 2024-07-12 |
|
PDBID: | 9io3 | Status: | HPUB -- hold until publication | Title: | D-Amino Acid Substituted Antimicrobial Peptides Derived from Tilapia piscidin 4 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9ci4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH (Apo form) | Authors: | Wanniarachchi, T.N., Bruner, S.D. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fxz | Status: | HPUB -- hold until publication | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | Deposition date: | 2024-07-02 |
|
PDBID: | 9ill | Status: | HPUB -- hold until publication | Title: | monomeric SarA-E89Q in complex with DNA | Authors: | Xia, B., Fu, D.H. | Deposition date: | 2024-06-30 | Release date: | 2025-09-30 |
|
PDBID: | 9ilk | Status: | HPUB -- hold until publication | Title: | monomeric SarA, truncation of residue 20-124 | Authors: | Xia, B., Fu, D.H. | Deposition date: | 2024-06-30 | Release date: | 2025-09-30 |
|
PDBID: | 9cf5 | Status: | HPUB -- hold until publication | Title: | STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1 ENV TRIMER AND 17B FAB | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-06-27 |
|
PDBID: | 9ijx | Status: | HPUB -- hold until publication | Title: | Crystal structure of the mouse Spef1 coiled-coil domain | Authors: | Ren, J., Li, D., Feng, W. | Deposition date: | 2024-06-25 | Sequence: | >Entity 1 GPGSYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
|
|
PDBID: | 9c9n | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH in complex with nickel and succinate | Authors: | Wanniarachchi, T.N., Bruner, S.D. | Deposition date: | 2024-06-14 |
|
PDBID: | 9c30 | Status: | HPUB -- hold until publication | Title: | Crystal structure of JF1cpCasp2 in complex with peptide inhibitor AcVDV(Dab)D-CHO | Authors: | Fuller, J.L., Shi, K. | Deposition date: | 2024-05-31 | Release date: | 2025-11-30 |
|
PDBID: | 8zoe | Status: | HPUB -- hold until publication | Title: | Structure of the canthaxanthin mutant PSI-4VCPI supercomplex in Nannochloropsis oceanica | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | Deposition date: | 2024-05-28 | Release date: | 2025-11-28 |
|