| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcr | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-1-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cya | | Status: | HPUB -- hold until publication | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with HEPES and putrescine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFAS(LLP)TCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLSDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIYLLAAALEHHHHHH
|
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gbi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - G93A | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - D101N | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9gbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 in complex with the cyclic peptide 5C6 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9gah | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9iv5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BRD4 in complex with compound7 | | Authors: | Du, Z., Chen, X., Cao, D., Jiang, Z., Xiong, B. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9cpz | | Status: | HPUB -- hold until publication | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with PMP and 4-guanidinobutanal | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-07-18 | | Sequence: | >Entity 1
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLSDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIYLLAAALEHHHHHH
|
|
| PDBID: | 9g6a | | Status: | HPUB -- hold until publication | | Title: | Peptide-Small Molecule Hybrids as Novel Selective Irreversible Cathepsin-K Inhibitors in Primary Osteoclasts and Human Lung Cancer Tissue | | Authors: | Turk, D., Loboda, J. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6m | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 30C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6n | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 40C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6o | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 45C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6p | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 50C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6l | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 20C using time-resolved serial synchrotron crystallography with Glucose at 60 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g5n | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 20C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5s | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 30C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5w | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 40C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5x | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 45C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g61 | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 50C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g4f | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the proton-dependent antibacterial peptide transporter SbmA in complex with FabS11-1 in lipid nanodiscs at pH 5.5, inward-closed state | | Authors: | Ghilarov, D., Beis, K. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9g4e | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the proton-dependent antibacterial peptide transporter SbmA in complex with FabS11-1 in lipid nanodiscs at pH 5.5, inward-open state | | Authors: | Ghilarov, D., Beis, K. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9ci4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH (Apo form) | | Authors: | Wanniarachchi, T.N., Bruner, S.D. | | Deposition date: | 2024-07-02 |
|
