| PDBID: | 9m9n | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23. | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9h | | Status: | HPUB -- hold until publication | | Title: | NMR structure of ProteinMPNN-designed ubiquitin variant R4 | | Authors: | Wu, K.-P., Chen, L.-Y., Chuang, W.-C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23 in Complex with Nirmatrelvir | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9ma1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MctB from Mycobacterium tuberculosis at 3.25 Angstroms resolution | | Authors: | Sun, D.M., Chen, L., Wu, M.H., Zang, J.Y., Tian, C.L. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9nqr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of primary RISC(pri-RISC) | | Authors: | Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9nqs | | Status: | HPUB -- hold until publication | | Title: | Structure of passenger-ejecting RISC (ej-RISC) | | Authors: | Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 7i8s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0024999-003 (A71EV2A-x1775) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 7i8t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030340-001 (A71EV2A-x2290) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 7i8u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0019110-002 (A71EV2A-x2454) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 7i8v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030531-001 (A71EV2A-x2629) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 7i8w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018935-002 (A71EV2A-x3066) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9qez | | Status: | HPUB -- hold until publication | | Title: | Carbonic anhydrase mutant | | Authors: | Mohsin, I., Papageorgiou, A.C. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9qfc | | Status: | HPUB -- hold until publication | | Title: | Tankyrase 2 ARC4 in complex with a pyrrolone-based inhibitor | | Authors: | Bosetti, C., Paakkonen, J., Lehtio, L. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9npm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Composite map of three pairs of dimeric VRC36 Fabs bound to HIV-1 BG505.T332N DS-SOSIP.664 Env trimer | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Zhou, T., Kwong, P.D. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9m7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human glucagon receptor (GCGR) in ligand free state resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9m7h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the orphan receptor GPRC5D in ligand free state resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9m7k | | Status: | HPUB -- hold until publication | | Title: | Heptamer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9qe2 | | Status: | HPUB -- hold until publication | | Title: | Mouse otoferlin (216-1931) in complex with an MSP2N2 lipid nanodisc (30 mol% DOPS, 10 mol% PI(4,5)P2) | | Authors: | Cretu, C., Moser, T. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1 | | Authors: | Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9qdk | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46 | | Authors: | Landi, G., Mangani, S., Pozzi, C. | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9qdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the aromatic oligoamide foldamer binder Affitin C10 fused to a coiled-coil domain | | Authors: | Sigl, J.C., Morozov, V., Huc, I. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5k | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5l | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qd3 | | Status: | HPUB -- hold until publication | | Title: | Gluthathion-S-Transferase StyI of Gordonia rubripertincta CWB2 | | Authors: | Burnik, J., Lienkamp, A.C., Hofmann, E., Tischler, D. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome model 2 | | Authors: | Hall, C., Chaplin, A. | | Deposition date: | 2025-03-05 |
|
