| PDBID: | 8xc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of LL-D49194-alpha-1 covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | | Authors: | Gao, R.Q., Tang, G.L., Cao, C. | | Deposition date: | 2023-12-08 | | Release date: | 2024-12-08 |
|
| PDBID: | 8rdc | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdb | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase N252E variant in complex with Fe and ACV under anaerobic conditions | | Authors: | Stead, A., Rabe, P., Schofield, C.J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8v94 | | Status: | HPUB -- hold until publication | | Title: | De novo designed homo-oligomeric TM domain aITL_04927 | | Authors: | Mravic, M., Anderson, C.T. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8f | | Status: | HPUB -- hold until publication | | Title: | The co-crystal structure of anti-HIV scFv and Utag. | | Authors: | Chen, S.H., Snow, C.D. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xao | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xap | | Status: | HPUB -- hold until publication | | Title: | Thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xaq | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8ray | | Status: | HPUB -- hold until publication | | Title: | ParA in complex with ATP | | Authors: | Mais, C.-N., Bange, G. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 8xa3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Penton capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Portal vertex capsomer of VZV B-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | penton capsomer of the VZV C-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9z | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | P-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9y | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | E-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9w | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | portal vertex capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Jiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
