| PDBID: | 9qod | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qol | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qom | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qov | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of [2Fe-2S]b D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qok | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u7o | | Status: | HPUB -- hold until publication | | Title: | Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to AOAA | | Authors: | Roy, A., Polepalli, S., Mondal, B., Dutta, S. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to O-Benzylhydroxylamine | | Authors: | Polepalli, S., Roy, A., Mondal, B., Dutta, S. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a P. Aeruginosa Gyrase | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qng | | Status: | HPUB -- hold until publication | | Title: | FOXO3 pS413 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnk | | Status: | HPUB -- hold until publication | | Title: | Tau pT245 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnl | | Status: | HPUB -- hold until publication | | Title: | BAD pS118 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Douat, C., Huc, I. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnq | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qny | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnx | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnh | | Status: | HPUB -- hold until publication | | Title: | Myc pS294 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qni | | Status: | HPUB -- hold until publication | | Title: | NOTCH4 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnj | | Status: | HPUB -- hold until publication | | Title: | Tau pS198 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnm | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2 | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qns | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnn | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7g | | Status: | HPUB -- hold until publication | | Title: | FGFR1 kinase domain with a macrocyclic compound 8g | | Authors: | Chen, X.J., Chen, Y.H. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
