Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9p27
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 at 1.33 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p28
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminaritriose at 1.30 angstrom resolution.
Authors:Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p29
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminaripentaose at 1.48 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2a
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminaripentaose at 1.45 angstrom resolution
Authors:Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2b
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminarihexaose at 1.62 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2c
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminarihexaose at 1.31 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2d
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 at 1.30 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2e
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G3G4G) oligosaccharide at 1.70 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2f
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G3G) oligosaccharide at 1.15 angstrom resolution
Authors:Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.10 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.30 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2i
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.25 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2j
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.40 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2k
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.30 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2l
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 at 1.10 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9p2m
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 at 1.42 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-06-11
PDBID:9rib
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of C273S mutant of mouse CDC14A
Authors:Shabbir, K., Jackisch, G., Knecht, W., Wilson, E., Dong, L., Friedman, T.B., Imtiaz, A., Logan, D.T.
Deposition date:2025-06-11
PDBID:9p1q
Status:HPUB -- hold until publication
Title:Crystal structure of Ube2E3
Authors:Cook, M.W., Brzovic, P.S., Stenkamp, R.E.
Deposition date:2025-06-10
Sequence:

>Entity 1


MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
PDBID:9p1j
Status:AUTH -- processed, waiting for author review and approval
Title:Staphylococcus aureus ClpP in complex with chimerabactin
Authors:Lee, R.E., Griffith, E.C.
Deposition date:2025-06-10
PDBID:9p1i
Status:AUTH -- processed, waiting for author review and approval
Title:Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin
Authors:Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S.
Deposition date:2025-06-10
PDBID:9p1a
Status:HPUB -- hold until publication
Title:B. pseudomallei rubrerythrin room temperature structure from LEAP-X device
Authors:Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S.
Deposition date:2025-06-09
PDBID:9p13
Status:AUTH -- processed, waiting for author review and approval
Title:Lysozyme in situ room temperature on site
Authors:Snell, M.E., Campomizzi, C.S., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09
PDBID:9p19
Status:HPUB -- hold until publication
Title:B. pseudomallei rubrerythrin room temperature structure
Authors:Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S.
Deposition date:2025-06-09
PDBID:9p16
Status:AUTH -- processed, waiting for author review and approval
Title:Thermolysin Room-Temperature In-Situ
Authors:Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09
PDBID:9p17
Status:HPUB -- hold until publication
Title:Thermolysin Room-Temperature In-Situ
Authors:Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J.
Deposition date:2025-06-09

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon