PDBID: | 9p27 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 at 1.33 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p28 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminaritriose at 1.30 angstrom resolution. | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p29 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminaripentaose at 1.48 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminaripentaose at 1.45 angstrom resolution | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminarihexaose at 1.62 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2c | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminarihexaose at 1.31 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 at 1.30 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G3G4G) oligosaccharide at 1.70 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2f | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G) oligosaccharide at 1.15 angstrom resolution | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2g | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.10 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.30 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.25 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2j | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.40 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2k | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.30 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2l | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 at 1.10 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p2m | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 at 1.42 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9rib | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of C273S mutant of mouse CDC14A | Authors: | Shabbir, K., Jackisch, G., Knecht, W., Wilson, E., Dong, L., Friedman, T.B., Imtiaz, A., Logan, D.T. | Deposition date: | 2025-06-11 |
|
PDBID: | 9p1q | Status: | HPUB -- hold until publication | Title: | Crystal structure of Ube2E3 | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | Deposition date: | 2025-06-10 | Sequence: | >Entity 1 MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
PDBID: | 9p1j | Status: | AUTH -- processed, waiting for author review and approval | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | Authors: | Lee, R.E., Griffith, E.C. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | Deposition date: | 2025-06-10 |
|
PDBID: | 9p1a | Status: | HPUB -- hold until publication | Title: | B. pseudomallei rubrerythrin room temperature structure from LEAP-X device | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | Deposition date: | 2025-06-09 |
|
PDBID: | 9p13 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Lysozyme in situ room temperature on site | Authors: | Snell, M.E., Campomizzi, C.S., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | Deposition date: | 2025-06-09 |
|
PDBID: | 9p19 | Status: | HPUB -- hold until publication | Title: | B. pseudomallei rubrerythrin room temperature structure | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | Deposition date: | 2025-06-09 |
|
PDBID: | 9p16 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Thermolysin Room-Temperature In-Situ | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | Deposition date: | 2025-06-09 |
|
PDBID: | 9p17 | Status: | HPUB -- hold until publication | Title: | Thermolysin Room-Temperature In-Situ | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | Deposition date: | 2025-06-09 |
|