| PDBID: | 9t1v | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of 17 bound to the PH domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t21 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 29 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t22 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of TA25.7 | | Authors: | Levy, C.W., Ortmayer, M. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t23 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 5 bound to the PH domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t29 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Jumonji domain-containing protein 2D with crystallization epitope mutation Q41R | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human PRKCBP1 Zinc finger MYND-type containing 8 with pentaglutamate tag | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2d | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Jumonji domain-containing protein 2B with crystallization epitope mutations L916G:R917A:A918D | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PRKCBP1 zinc finger MYND-type containing 8 with crystallization epitope mutations N221R:M226H | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bromodomain containing protein 1 with crystal epitope mutations P566E:V569R | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Jumonji domain-containing protein 2B with crystallization epitope mutations L916G:R917A:A918D | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t2i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SP100 nuclear antigen with crystallization epitope mutations N816D:T820R | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t1p | | Status: | HPUB -- hold until publication | | Title: | Human PI3Kdelta in complex with IOA-288 | | Authors: | Graedler, U., Augustin, M., Goesser, C., Kiefersauer, R. | | Deposition date: | 2025-10-21 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
|
|
| PDBID: | 9t18 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of protein kinase CK2 catalytic subunit CK2alpha (CSNK2A1 gene product) in complex with the indenoindole-precursor compound JC0151 | | Authors: | Werner, C., Jose, J., Le Borgne, M., Niefind, K. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9t1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of D1228V c-MET bound by glesatinib. | | Authors: | Collie, G.W., Russell, I.C. | | Deposition date: | 2025-10-21 |
|
| PDBID: | 9x8s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV capsid peptide (K4ac) | | Authors: | Chen, S.D.C., Kang, S.S.K. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9x8u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV capsid peptide (K8ac) | | Authors: | Chen, S.D.C., Kang, S.S.K. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9x9i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | complex of TCR1414_2-TGFbetaR2(-1)-HLA-DR4, a TGFbetaR2(-1)-HLA-DR4, with a TGFbetaR2(-1) specific TCR1414_2 | | Authors: | Shi, J.L., Wu, D.C. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9yt4 | | Status: | HPUB -- hold until publication | | Title: | Local refinement of LP.8.1 spike (3-RBD-down), RBD-A and NTD-C | | Authors: | Wang, Y., Hu, Y., Chen, Z., Liang, B., Xie, X. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9yt7 | | Status: | HPUB -- hold until publication | | Title: | Local refinement of LP.8.1 spike (3-RBD-down), RBD-C and NTD-B | | Authors: | Wang, Y., Hu, Y., Chen, Z., Liang, B., Xie, X. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9t0z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HPFcold Bound Hibernating C. burnetii 30S Ribosome | | Authors: | Stuart, W.S., Isupov, M.N., Harmer, N.J. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9t0u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | STRUCTURE OF PROTEIN KINASE CK2 CATALYTIC SUBUNIT (ISOFORM CK2ALPHA''; CSNK2A2 gene product) IN COMPLEX WITH THE INDENOINDOLE-TYPE INHIBITOR 4b (AR14) | | Authors: | Werner, C., Jose, J., Le Borgne, M., Niefind, K. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9t0t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the correct enantiomer bound to the PH domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9t0v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of H416C NikA mutant from Escherichia coli in complex with Fe(III)-EDTA | | Authors: | Cavazza, C., Menage, S. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9x87 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TGFbetaR2(-1) specific TCR1414_1 | | Authors: | Shi, J.L., Wu, D.C. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 13tc | | Status: | PROC -- to be processed | | Title: | Orf9b homodimer in complex with fragment ZINC000039281982 | | Authors: | San Felipe, C.J., Fraser, J.S. | | Deposition date: | 2025-10-19 |
|
