PDBID: | 8vbh | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbc | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbf | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8rdc | Status: | HPUB -- hold until publication | Title: | Galectin-1 in complex with thiogalactoside derivative | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | Deposition date: | 2023-12-07 |
|
PDBID: | 8rc6 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | Deposition date: | 2023-12-06 | Sequence: | >Entity 1 AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|
PDBID: | 8rci | Status: | HPUB -- hold until publication | Title: | Human p53 DNA-binding domain bound to DARPin C10 | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | Deposition date: | 2023-12-06 |
|
PDBID: | 8r2p | Status: | HPUB -- hold until publication | Title: | YZwIdeal x16 a scaffold for cryo-EM of small proteins of interest crystallizing in space group 19 (P 21 21 21) | Authors: | Moche, M., Friberg, O., Nygren, P.A., Nilvebrant, J. | Deposition date: | 2023-11-07 |
|
PDBID: | 8r2n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the BeeR filament | Authors: | Bergeron, J.R.C., Kollman, J.M. | Deposition date: | 2023-11-07 |
|
PDBID: | 8uwq | Status: | HPUB -- hold until publication | Title: | Crystal structure of BT1282 GH18-like from Bacteroides thetaiotaomicron VPI-5482 | Authors: | Sastre, D.E., Sultana, N., Navarro, M.V.A.S., Sundberg, E.J. | Deposition date: | 2023-11-07 |
|
PDBID: | 8uro | Status: | HPUB -- hold until publication | Title: | Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | Deposition date: | 2023-10-26 |
|
PDBID: | 8ura | Status: | HPUB -- hold until publication | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.6 A resolution (space group P21) | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | Deposition date: | 2023-10-25 |
|
PDBID: | 8qqh | Status: | HPUB -- hold until publication | Title: | Structure of beta-galactosidase from Desulfurococcus amyloliticus | Authors: | Samygina, V.R., Kil, Y., Sergeev, R.S., Rychkov, G.N. | Deposition date: | 2023-10-04 |
|
PDBID: | 8uen | Status: | HPUB -- hold until publication | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.3 A (P 21 21 2) | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | Deposition date: | 2023-10-02 |
|
PDBID: | 8wjx | Status: | HPUB -- hold until publication | Title: | ADP-bound purinergic receptor 1 in complex with miniGs/q | Authors: | Gu, Q.C., Tang, W.Q. | Deposition date: | 2023-09-26 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qce | Status: | HPUB -- hold until publication | Title: | Dispersin from Lactiplantibacillus paraplantarum DispLp | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-25 | Release date: | 2025-02-25 |
|
PDBID: | 8qb6 | Status: | HPUB -- hold until publication | Title: | Dispersin from Terribacillus saccharophilus DispTs2 | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-24 | Release date: | 2025-02-28 |
|
PDBID: | 8qak | Status: | HPUB -- hold until publication | Title: | Dispersin from Terribacillus saccharophilus DispTs3 | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | Deposition date: | 2023-08-22 | Release date: | 2025-02-28 |
|
PDBID: | 8p8l | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the nucleosome-bound human BCL7A | Authors: | Martin, F., Bergamin, E. | Deposition date: | 2023-06-01 | Release date: | 2024-12-01 |
|
PDBID: | 8se3 | Status: | HPUB -- hold until publication | Title: | Structure of Full-length Human Protein Kinase C Beta 1 (PKCBI) in the Active Conformation | Authors: | Cong, A.T.Q., Witter, T.L., Bruinsma, E.S., Jayaraman, S., Hawse, J.R., Goetz, M.P., Schellenberg, M.J. | Deposition date: | 2023-04-07 | Release date: | 2024-10-07 |
|
PDBID: | 7r2n | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | elongated Cascade complex from type I-A CRISPR-Cas system in an active state | Authors: | Hu, C., Ni, D., Nam, K.H., Terns, M., Stahlberg, H. | Deposition date: | 2022-02-04 |
|
PDBID: | 2m95 | Status: | POLC -- waiting for a policy decision | Title: | Ferredoxin Competes with Bacterial Frataxin in Binding to the Desulfurase IscS | Authors: | Konarev, P.V., Iannuzzi, C., Adinolfi, S., Roche, B., Kelly, G., Simon, L., Martin, S.R., Py, B., Barras, F., Svergun, D.I. | Deposition date: | 2013-06-03 |
|