| PDBID: | 9ubo | | Status: | HPUB -- hold until publication | | Title: | The structure of type III CRISPR-associated deaminase in complex cA6 and ATP, state 5 | | Authors: | Kong, J.P., Wu, W.Q., Li, Z.X., Xiao, Y.B. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9nzm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GMPPNP and Covalently Bound to an Adduct of {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}-5,6,7,8-tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-[(2Z)-2-fluoro-3-(pyridin-2-yl)prop-2-enoyl]piperazin-2-yl}acetonitrile | | Authors: | Sheriff, S., Pokross, M., Witmer, M. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9u8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qkb | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9mc9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human UBA1-UBE2O-Ub -Recruitment state 5 | | Authors: | Chen, P.-T., Wu, K.-P. | | Deposition date: | 2025-03-17 |
|
| PDBID: | 9nt0 | | Status: | HPUB -- hold until publication | | Title: | OXA-23-meropenem, pH 7.5 | | Authors: | Smith, C.A., Toth, M., Stewart, N.K., Vakulenko, S.B. | | Deposition date: | 2025-03-17 | | Sequence: | >Entity 1
MNKYFTCYVVASLFLSGCTVQHNLINETPSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTF(KCX)MLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII
|
|
| PDBID: | 9nsw | | Status: | HPUB -- hold until publication | | Title: | apo-OXA-23, pH 7.5 | | Authors: | Smith, C.A., Toth, M., Stewart, N.K., Vakulenko, S.B. | | Deposition date: | 2025-03-17 | | Sequence: | >Entity 1
MNKYFTCYVVASLFLSGCTVQHNLINETPSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKKINLYGNALSRANTEYVPASTF(KCX)MLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLGEAMKLSAVPVYQELARRIGLDLMQKEVKRIGFGNAEIGQQVDNFWLVGPLKVTPIQEVEFVSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGKIVAFALNMEMRSEMPASIRNELLMKSLKQLNII
|
|
| PDBID: | 9no1 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-ET map of the VZV capsid vertex (5-fold axis). | | Authors: | Oliver, S.L., Chen, M. | | Deposition date: | 2025-03-07 | | Release date: | 2026-03-07 |
|
| PDBID: | 9qe2 | | Status: | HPUB -- hold until publication | | Title: | Mouse otoferlin (216-1931) in complex with an MSP2N2 lipid nanodisc (30 mol% DOPS, 10 mol% PI(4,5)P2) | | Authors: | Cretu, C., Moser, T. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9qdd | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium acetate buffer at pH 5.3 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2025-04-03 |
|
| PDBID: | 9qdg | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe] hydrogenase crystallized in the sodium propionate buffer at pH 5.0 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2026-03-06 |
|
| PDBID: | 9m61 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 5-HT2BR in complex with RS127445 | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m60 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 5-HT2BR in complex with ritanseirn | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nlk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [0,7,13,P-->14] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,7,13) base pairs, 1 nt sticky ends, and 5'' phosphates containing a semi-junction that becomes left-handed | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9nlu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Y20S (Sec18-Sec17-Sec9-Sso1-Snc1) EDTA - Class 5 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9nkt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [0,8,12P-->13] Shifted tensegrity triangle with an (arm,center,arm) distribution of (0,8,12) base pairs, 1 nt sticky ends, and 5'' phosphates containing a semi-junction that becomes left-handed | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9m2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of okaE in complex with a-ketoglutarate and okaramine A at 2.5 angstroms resolution. | | Authors: | Liu, T.H., Yan, W.P. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9nic | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(2-amino-3-fluorophenyl)-5-methylisoxazole-3-carboxamide | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q92 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of bacterial transcription intermediate complex mediated by activator PspF containing nifH promoter DNA containing mismatch from -11 to -8 - conformation 5 | | Authors: | Gao, F., Zhang, X. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nhg | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(2-aminophenyl)-5-methylisoxazole-3-carboxamide | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9q86 | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 9.5 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9nfn | | Status: | HPUB -- hold until publication | | Title: | Nanotube of Y5 - (5 protomer) | | Authors: | Das, A., Conticello, V. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ifq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with 5-hydroxymethylfurfural | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9nd7 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
