PDBID: | 9uad | Status: | HPUB -- hold until publication | Title: | Crystal structure of the OkaE-M64A mutant with a-ketoglutarate and okaramine A | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | Deposition date: | 2025-03-31 |
|
PDBID: | 9uaf | Status: | HPUB -- hold until publication | Title: | Crystal structure of the OkaE-M71A mutant with a-ketoglutarate | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | Deposition date: | 2025-03-31 |
|
PDBID: | 9uag | Status: | HPUB -- hold until publication | Title: | Crystal structure of the OkaE-M71A mutant with a-ketoglutarate and okaramine A | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | Deposition date: | 2025-03-31 |
|
PDBID: | 9uah | Status: | HPUB -- hold until publication | Title: | Crystal structure of the OkaE-W79A mutant with a-ketoglutarate and okaramine A | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | Deposition date: | 2025-03-31 |
|
PDBID: | 9nzd | Status: | HPUB -- hold until publication | Title: | Crystal structure of AfNth1-K122A mutant bound to Tg-DNA duplex complex in an intermediate state | Authors: | Hitomi, K., Arvai, A.S., Syed, A., Parikh, S., Tainer, J.A. | Deposition date: | 2025-03-31 |
|
PDBID: | 9nz0 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of vaccine elicited antibody 22F5 bound to the post-fusion conformation of the LayV-F glycoprotein. | Authors: | Kumar, U., May, A., Acharya, P. | Deposition date: | 2025-03-31 |
|
PDBID: | 9nzf | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab MAM01 in complex with minor repeat region peptide from circumsporozoite protein | Authors: | Jain, M., Wilson, I.A. | Deposition date: | 2025-03-31 |
|
PDBID: | 9nzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state | Authors: | Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A. | Deposition date: | 2025-03-31 |
|
PDBID: | 9nz2 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of antibody 22F5 in complex with pre-fusion stabilized LayV-F | Authors: | May, A.J., Kumar, U., Acharya, P. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qqi | Status: | HPUB -- hold until publication | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 untreated control of a redox cycling experiment | Authors: | Wissink, M., Wagner, T. | Deposition date: | 2025-03-31 | Sequence: | >Entity 1 MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
PDBID: | 9qq3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human carbonic anhydrase VII in complex with a benzenesufonamide derivative containing the duloxetine moiety | Authors: | D''Ambrosio, K., Di Fiore, A., De Simone, G. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qq2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human carbonic anhydrase VII in complex with a benzenesulfonamide derivative containing the duloxetine moiety. | Authors: | Di Fiore, A., D''Ambrosio, K., De Simone, G. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qqe | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the SN230G6 Fab - HLA-A*02:01 human alloantibody-HLA complex | Authors: | Zampieri, V., Priddey, A., Schneider, S., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qqf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qq4 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 as isolated form at 1.07-A resolution | Authors: | Wissink, M., Wagner, T. | Deposition date: | 2025-03-31 |
|
PDBID: | 9qq5 | Status: | HPUB -- hold until publication | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state | Authors: | Wissink, M., Wagner, T. | Deposition date: | 2025-03-31 | Sequence: | >Entity 1 MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
PDBID: | 9qpv | Status: | HPUB -- hold until publication | Title: | Pseudomonas aeruginosa Ptx2 toxin | Authors: | Shatskiy, D., Belyy, A. | Deposition date: | 2025-03-29 |
|
PDBID: | 9u9m | Status: | HPUB -- hold until publication | Title: | 2,2''-bipyridine linked DNA oligomer (CGCGAAT[BrU]CGCG) in the presence of Ni2+ ion | Authors: | Atugi, T., Kanazawa, H., Sugiyama, Y., Fujiwara, S., Ono, A., Kondo, J. | Deposition date: | 2025-03-28 |
|
PDBID: | 9nyq | Status: | HPUB -- hold until publication | Title: | Crystal structure of CDK2/CyclinE1 in complex with Cpd 3 | Authors: | Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P. | Deposition date: | 2025-03-28 |
|
PDBID: | 9nyr | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 24 | Authors: | Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P. | Deposition date: | 2025-03-28 |
|
PDBID: | 9nys | Status: | HPUB -- hold until publication | Title: | Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick | Authors: | KanalElamparithi, B., Caglayan, M. | Deposition date: | 2025-03-28 |
|
PDBID: | 9nyd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | Deposition date: | 2025-03-27 |
|
PDBID: | 9nyf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume) | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | Deposition date: | 2025-03-27 |
|
PDBID: | 9nye | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume) | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | Deposition date: | 2025-03-27 |
|
PDBID: | 9nyk | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | Deposition date: | 2025-03-27 |
|