| PDBID: | 8zlx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of mPPEF2 IQ motif/apo-CaM Complex | | Authors: | Liu, J., Ding, Y.Z., Li, J.C., Liu, W. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8zlw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of RDGC IQ motif/dCaM Complex | | Authors: | Liu, J., Ding, Y.Z., Li, J.C., Liu, W. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9feg | | Status: | HPUB -- hold until publication | | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | | Authors: | Bosetti, C., Lehtio, L. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlm | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bvx | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | | Authors: | Liu, W.R., Blankenship, L.R. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 9bw3 | | Status: | HPUB -- hold until publication | | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlk | | Status: | HPUB -- hold until publication | | Title: | PWWP domain from human DNMT3B | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9fdp | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdh | | Status: | HPUB -- hold until publication | | Title: | Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdn | | Status: | HPUB -- hold until publication | | Title: | Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8zkj | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of apo-LDHC | | Authors: | Wu, C.Y., Wang, H.L. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | | Authors: | Escalante, C.R. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2
(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3
(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
| PDBID: | 9bu9 | | Status: | HPUB -- hold until publication | | Title: | Mixed-valent (2/3) dimanganese SfbO | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bua | | Status: | HPUB -- hold until publication | | Title: | SfbO reconstituted with Mn(II) anaerobically | | Authors: | Liu, C., Rittle, J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9btk | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-108T | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 9btr | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-163 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 9fc6 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc7 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 99% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc8 | | Status: | HPUB -- hold until publication | | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zip | | Status: | HPUB -- hold until publication | | Title: | Mouse left ventricle actin and myosin complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8ziu | | Status: | HPUB -- hold until publication | | Title: | Mouse MYH6 R404Q left ventricle actin and myosin complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj1 | | Status: | HPUB -- hold until publication | | Title: | Human left ventricle F-actin | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zix | | Status: | HPUB -- hold until publication | | Title: | RAT skeletal muscle F-actin | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9fbt | | Status: | HPUB -- hold until publication | | Title: | Structure of KPC-2 complexed with benzoxaborole AK-431 | | Authors: | Beer, M., Tooke, C.L., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9fbk | | Status: | HPUB -- hold until publication | | Title: | Diheme cytochrome c Kustd1711 from Kuenenia stuttgartiensis, without glycerol cryoprotectant | | Authors: | Hauser, D., Barends, T.R.M. | | Deposition date: | 2024-05-14 |
|
