| PDBID: | 9qul | | Status: | HOLD -- hold until a certain date | | Title: | Zn(II)-bound de novo protein scaffold TFD-EH T87E | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATIELSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9qun | | Status: | HPUB -- hold until publication | | Title: | apPol-nucleotide complex | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9uef | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of AvmO1 mutant - Y282R+V352L and Alchivemycin A | | Authors: | Guo, N., Dong, H., Han, Y., Yang, J., Lei, X. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with Pseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o47 | | Status: | HPUB -- hold until publication | | Title: | RNA dodecamer containing a serinol nucleic acid. | | Authors: | Harp, J.M., Egli, M.E. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9udq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udw | | Status: | HPUB -- hold until publication | | Title: | G6P bound SLC37A2 in a symmetric inward-facing state by adding G6P | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udx | | Status: | HPUB -- hold until publication | | Title: | apo SLC37A2 in a symmetric outward-facing state by adding G6P | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mn(III)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL) | | Authors: | Moussawi, M.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsn | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallized with indole-3-acetic acid | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qso | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallised with indole-3-pyruvate | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
