| PDBID: | 9lk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lko | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lku | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkp | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Enterobacter cloaca transaldolase | | Authors: | Kamitori, S. | | Deposition date: | 2025-01-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
| PDBID: | 9lkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22076 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lks | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-16 | | Release date: | 2026-01-16 |
|
| PDBID: | 9mv8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9mvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mv6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9mv7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9mv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9mvf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
| PDBID: | 9mvc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-15 | | Release date: | 2026-01-15 |
|
