| PDBID: | 9i1z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9i21 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to SAH | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-17 | | Release date: | 2026-01-17 |
|
| PDBID: | 9i1u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-17 | | Release date: | 2026-01-17 |
|
| PDBID: | 9lll | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llr | | Status: | HPUB -- hold until publication | | Title: | The designed collagen heterotrimer peptides with various stabilizing side chain pairs | | Authors: | Zhang, R.X., Xu, F., Fan, S.L. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll3 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Enterobacter cloaca transaldolase in complex with D-fructose-6-phosphate. | | Authors: | Kamitori, S. | | Deposition date: | 2025-01-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
| PDBID: | 9llw | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-17 | | Release date: | 2026-01-17 |
|
| PDBID: | 9llc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llm | | Status: | HPUB -- hold until publication | | Title: | Structure of C-Terminal of AB40 Peptide containing GXXXG Motif in SDS Micelles | | Authors: | Sarkar, D., Bhunia, A. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llp | | Status: | HPUB -- hold until publication | | Title: | A designed collagen heterotrimer with varous stabilizing side chain pairs | | Authors: | Zhang, R.X., Xu, F., Fan, S.L. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llo | | Status: | HPUB -- hold until publication | | Title: | a designed heterotrimer combining natural and synthetic fragments | | Authors: | Zhang, R.X., Xu, F., Fan, S.L. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lln | | Status: | HPUB -- hold until publication | | Title: | a collagen heterotrimer combining natural and synthetic fragments | | Authors: | Zhang, R.X., Xu, F., Fan, S.L. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lls | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ornithine decarboxylase H346A mutant | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llq | | Status: | HOLD -- hold until a certain date | | Title: | Structure of TetR2 and DNA probe | | Authors: | He, W., Wen, Y. | | Deposition date: | 2025-01-17 | | Release date: | 2026-01-17 |
|
| PDBID: | 9lly | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RSV pre-F (sc9-10 DS-Cav1, strain A2) in complex with Fabs 1A2 and 1B6 | | Authors: | Liu, L., Zheng, Q., Li, S. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lle | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9llh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-17 |
|
