| PDBID: | 8rcz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the enoyl-ACP reductase FabV from Pseudomonas aeruginosa with NADH cofactor | | Authors: | Vandebroek, L., Van Olmen, F., Voet, A.R.D., Verwilst, P. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8v90 | | Status: | HPUB -- hold until publication | | Title: | TtgR variant 3A7 with naltrexone | | Authors: | Acheson, J.F., Lee, D., Ramen, S. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8f | | Status: | HPUB -- hold until publication | | Title: | The co-crystal structure of anti-HIV scFv and Utag. | | Authors: | Chen, S.H., Snow, C.D. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8r8v | | Status: | HPUB -- hold until publication | | Title: | Human PADI4 in complex with cyclic peptide PADI4_11 | | Authors: | Benton, D.J., Bertran, M.T., Walport, L.J. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8r8b | | Status: | HPUB -- hold until publication | | Title: | Wnt binding to COPalpha and COPBeta2 directs secretion on extracellular vesicles | | Authors: | Gurriaran-Rodriguez, U., Datzkiw, D., Radusky, L.G., Fisher, F., Xiao, F., Ming, H., De Repentigny, Y., Kothary, R., Serrano, L., Rojas, A.L., Hierro, A., Rudnicki, M.A. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r7x | | Status: | HPUB -- hold until publication | | Title: | Kras G12D in complex with compound 4 | | Authors: | Kessler, D., Zak, K.M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r6v | | Status: | HPUB -- hold until publication | | Title: | The complex of glycogen phosphorylase with EGCG (epigallocatechin gallate) and caffeine. | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-11-23 | | Release date: | 2025-05-23 |
|
| PDBID: | 8r76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ficin C crystal form I | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r78 | | Status: | HPUB -- hold until publication | | Title: | Ficin D cystein protease | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
