PDBID: | 9o8s | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Hong Kong/485197/2014 (H3N2) | Authors: | Jo, G., Ward, A.B. | Deposition date: | 2025-04-16 |
|
PDBID: | 9o8t | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | Authors: | Jo, G., Ward, A.B. | Deposition date: | 2025-04-16 |
|
PDBID: | 9o8w | Status: | HPUB -- hold until publication | Title: | Crystal structure of an MKP5 mutant, Y435F, in complex with an allosteric inhibitor | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | Deposition date: | 2025-04-16 |
|
PDBID: | 9qxo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human nucleoside diphosphate kinase B mutant H122G in complex with RDP | Authors: | Feracci, M., Chazot, A. | Deposition date: | 2025-04-16 |
|
PDBID: | 9qxp | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human nucleoside diphosphate kinase B mutant H122G in complex with aS-RDP-Sp. | Authors: | Feracci, M., Chazot, A. | Deposition date: | 2025-04-16 |
|
PDBID: | 9qy4 | Status: | HPUB -- hold until publication | Title: | GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P) | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | Deposition date: | 2025-04-16 |
|
PDBID: | 9o7k | Status: | HPUB -- hold until publication | Title: | Cryo-EM of pi-conjugated Peptide 2 (9 strands) | Authors: | Rich-New, S.T., Wang, R., Zia, A., Tovar, J.D., Wang, F. | Deposition date: | 2025-04-15 |
|
PDBID: | 9o7m | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of YfdQ Reveals a Widespread Novel Family of Bacteriophage-Associated Proteins with Shell-Like Assemblies | Authors: | Guzzo, C.R., Araujo, G.G., Merighi, D.G.S. | Deposition date: | 2025-04-15 |
|
PDBID: | 9o84 | Status: | HPUB -- hold until publication | Title: | Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form) | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | Deposition date: | 2025-04-15 |
|
PDBID: | 9qwv | Status: | HPUB -- hold until publication | Title: | Trypanosoma cruzi enoyl-CoA hydratase | Authors: | Brannigan, J.A., Dodson, E.J. | Deposition date: | 2025-04-15 | Sequence: | >Entity 1 MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
PDBID: | 9qwq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human vault protein - committed conformation | Authors: | Lapenta, F., Marechal, N., Durand, A., Aupic, J., Cassetta, A. | Deposition date: | 2025-04-15 |
|
PDBID: | 9qwt | Status: | HPUB -- hold until publication | Title: | Mouse Ribosome RPS15 (uS19) P131S rotated-2 PRE state | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | Deposition date: | 2025-04-15 |
|
PDBID: | 9qx6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator fragment | Authors: | Morozov, V., Merk, D., Nawa, F. | Deposition date: | 2025-04-15 |
|
PDBID: | 9qxm | Status: | HPUB -- hold until publication | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with DMJ | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | Deposition date: | 2025-04-15 |
|
PDBID: | 9qx4 | Status: | HPUB -- hold until publication | Title: | Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | Deposition date: | 2025-04-15 |
|
PDBID: | 9uhk | Status: | HPUB -- hold until publication | Title: | Crystal structure of the catalytic domain of USP7 bound to a hPiT1 peptide | Authors: | Wang, S.-C., Sun, Y.-J. | Deposition date: | 2025-04-14 |
|
PDBID: | 9o6p | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Mpro S113C in complex with Pfizer Intravenous Inhibitor PF-00835231 | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2025-04-14 |
|
PDBID: | 9o6q | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Mpro L115A in complex with Pfizer Intravenous Inhibitor PF-00835231 | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2025-04-14 |
|
PDBID: | 9o72 | Status: | HPUB -- hold until publication | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | Deposition date: | 2025-04-14 |
|
PDBID: | 9o70 | Status: | HPUB -- hold until publication | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | Authors: | Xing, E.R., Yatsunyk, L.A. | Deposition date: | 2025-04-14 |
|
PDBID: | 9o74 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Mpro L115M in complex with Pfizer Intravenous Inhibitor PF-00835231 | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | Deposition date: | 2025-04-14 |
|
PDBID: | 9qw3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qw2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qw4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
PDBID: | 9qwl | Status: | HPUB -- hold until publication | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | Authors: | Sauer, U.H., Cisneros, D.A. | Deposition date: | 2025-04-14 | Sequence: | >Entity 1 (MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|