PDBID: | 8yxz | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state1 | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy1 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state3 | Authors: | Nishida, Y., Kishikawa, J., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yxu | Status: | HPUB -- hold until publication | Title: | Crystal structure of CsoS1A/B (modeled with CsoS1A) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yya | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Concanavalin A Complexed with 5-Fluorouracil | Authors: | Rasheed, S., Arif, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yy0 | Status: | HPUB -- hold until publication | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state2 | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba6 | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9l | Status: | HPUB -- hold until publication | Title: | RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide | Authors: | Moreno, R.Y., Zhang, Y.J. | Deposition date: | 2024-04-02 |
|
PDBID: | 8ywt | Status: | HPUB -- hold until publication | Title: | The isolated Vo domain of V/A-ATPase from Thermus thermophilus. | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | Deposition date: | 2024-04-01 |
|
PDBID: | 8ywu | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-04-01 |
|
PDBID: | 8ywv | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-04-01 |
|
PDBID: | 9evo | Status: | HPUB -- hold until publication | Title: | Plasmodium falciparum apical membrane antigen 3D7 | Authors: | Bentley, G.A., Saul, F.A., Vulliez-Le Normand, B. | Deposition date: | 2024-03-31 |
|
PDBID: | 9b8m | Status: | HPUB -- hold until publication | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | Deposition date: | 2024-03-31 |
|
PDBID: | 9b8n | Status: | HPUB -- hold until publication | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | Deposition date: | 2024-03-31 |
|
PDBID: | 9evm | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | MSOX movie series dataset 30 (34.5 MGy) for nitrite bound BrJNiR (Cu containing nitrite reductase (NirK) from Bradyrhizobium japonicum USDA110 at pH 8. | Authors: | Rose, S.L., Ferroni, F.M., Horrell, S., Brondino, C.D., Eady, R.R., Jaho, S., Hough, M.A., Owen, A.L., Antonyuk, S.V., Hasnain, S.S. | Deposition date: | 2024-03-30 |
|
PDBID: | 8yw9 | Status: | HOLD -- hold until a certain date | Title: | A membrane transporter complex with substrate | Authors: | Shi, J.H., Liang, J.M., Ma, D. | Deposition date: | 2024-03-30 | Release date: | 2025-03-30 |
|
PDBID: | 8yw8 | Status: | HOLD -- hold until a certain date | Title: | A membrane transporter complex with inhibitor | Authors: | Shi, J.H., Liang, J.M., Ma, D. | Deposition date: | 2024-03-30 | Release date: | 2025-03-30 |
|
PDBID: | 9b8c | Status: | HPUB -- hold until publication | Title: | RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | Deposition date: | 2024-03-29 |
|
PDBID: | 8yvd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yve | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvf | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 | Sequence: | >Entity 1 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2 MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3 RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
PDBID: | 8yvj | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|