Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9hu5
Status:HPUB -- hold until publication
Title:Asymmetric unit from transcribing single-layered particle of bacteriophage phi6
Authors:Ilca, S.L., Kumpula, E.-P., Huiskonen, J.T.
Deposition date:2024-12-20
PDBID:9hu6
Status:HPUB -- hold until publication
Title:Asymmetric unit from transcribing single-layered particle of bacteriophage phi6 in an over-expanded state
Authors:Ilca, S.L., Kumpula, E.-P., Huiskonen, J.T.
Deposition date:2024-12-20
PDBID:9mn0
Status:HPUB -- hold until publication
Title:E. coli SR1 single-ring GroEL templated into pseudo-double-ring complex with PBZ1587 inhibitor
Authors:Johnson, S.M., Chen, Q.
Deposition date:2024-12-20
PDBID:9mn1
Status:AUTH -- processed, waiting for author review and approval
Title:E. coli SR1 single-ring GroEL oligomer
Authors:Johnson, S.M., Chen, Q.
Deposition date:2024-12-20
PDBID:9mn3
Status:AUTH -- processed, waiting for author review and approval
Title:E. coli GroES-GroEL-GroES football complex
Authors:Johnson, S.M., Chen, Q.
Deposition date:2024-12-20
PDBID:9mmf
Status:HPUB -- hold until publication
Title:First structure of Five-tetrad G-Quadruplex
Authors:Eyiolowope, J., Xing, E.R., Yatsunyk, L.A.
Deposition date:2024-12-20
PDBID:9ht7
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-19
PDBID:9ht5
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid
Authors:Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G.
Deposition date:2024-12-19
PDBID:9hs9
Status:HPUB -- hold until publication
Title:Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free
Authors:Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A.
Deposition date:2024-12-19
PDBID:9mlx
Status:AUTH -- processed, waiting for author review and approval
Title:Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker
Authors:Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M.
Deposition date:2024-12-19
PDBID:9ht3
Status:HPUB -- hold until publication
Title:Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate
Authors:Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H.
Deposition date:2024-12-19
Sequence:

>Entity 1


AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
PDBID:9mld
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella
Authors:Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F.
Deposition date:2024-12-19
PDBID:9hrs
Status:HPUB -- hold until publication
Title:ZnT1 CTD regulation
Authors:Ben-Yosef, T.E., Zarivach, R., Shahar, A.
Deposition date:2024-12-18
PDBID:9hrk
Status:HPUB -- hold until publication
Title:Cytochrome P460 from Methyloccocus capsulatus in the ferrous state (single crosslink from Lys)
Authors:Pfalzgraf, H.E., Adams, H.R., Jaho, S., Hough, M.A.
Deposition date:2024-12-18
PDBID:9hrj
Status:HPUB -- hold until publication
Title:Structure of YIUA from Yersinia ruckeri
Authors:Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G.
Deposition date:2024-12-18
PDBID:9hrp
Status:HPUB -- hold until publication
Title:Structure of YIUA from Yersinia ruckeri with iron
Authors:Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G.
Deposition date:2024-12-18
Sequence:

>Entity 1


SENITDMAGRSVVIPAKVERILLGEGRLFYAVSLLEGQKPFDRIVGWQGDFRKLDTQTYAVYKAKFPQVDNIPLIGNTTADSISPEKVLTLNPDIAIFGLSGHGPGKNSELVKQLEKAGVPVVFVDFRTSPLKNTLPSMRVLGKVLHREQQANDYIKFYEDNVRKVTEITSKIPADKKPSVFIELRAGAMEECCGTAGKGNMGDFIDQAGGNNMAKNLLPGALGTVNLEKVLSTNPDIYIASGGKAPDNNAPGVSLGAQVTKEQAQSSLQTILDRKGINTLSAVKNGRSYGIWHNFYNSPYNVLAIQSFAKWFYPQQFADLDPNNTMNSLYSQFLAIEPTGTYWVDSTK
PDBID:9hs4
Status:HPUB -- hold until publication
Title:Cytochrome P460 from Methyloccocus capsulatus (double crosslink from Lys)
Authors:Pfalzgraf, H.E., Adams, H.R., Mikolajek, H., Sanchez-Weatherby, J., Sandy, J., Hough, M.A.
Deposition date:2024-12-18
PDBID:9hs6
Status:HPUB -- hold until publication
Title:Cytochrome P460 from Methyloccocus capsulatus (double crosslink from Lys), aged
Authors:Pfalzgraf, H.E., Adams, H.R., Mikolajek, H., Sanchez-Weatherby, J., Sandy, J., Hough, M.A.
Deposition date:2024-12-18
PDBID:9l2i
Status:HPUB -- hold until publication
Title:Cryo-EM structure of soluble methane monooxygenase hydroxylase from Methylosinus sporium 5
Authors:Hwang, Y., Pozharski, E., Lee, S.J.
Deposition date:2024-12-17
PDBID:9hpz
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis
Authors:Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E.
Deposition date:2024-12-16
Release date:2025-12-16
PDBID:9hpt
Status:HPUB -- hold until publication
Title:Crystal structure of OXA-57
Authors:Bragginton, E.C., Hinchliffe, P., Spencer, J.
Deposition date:2024-12-16
PDBID:9hpu
Status:HPUB -- hold until publication
Title:Crystal structure of OXA-57
Authors:Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J.
Deposition date:2024-12-16
PDBID:9hqh
Status:HPUB -- hold until publication
Title:SARM1 TIR domain in complex with compound 28-ADPR
Authors:Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J.
Deposition date:2024-12-16
PDBID:9hpw
Status:HPUB -- hold until publication
Title:Crystal structure of meropenem bound to OXA-57
Authors:Bragginton, E.C., Hinchliffe, P., Spencer, J.
Deposition date:2024-12-16
PDBID:9hpy
Status:HPUB -- hold until publication
Title:Crystal structure of avibactam bound to OXA-57
Authors:Bragginton, E.C., Hinchliffe, P., Spencer, J.
Deposition date:2024-12-16

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon