| PDBID: | 9n8y | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8z | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n90 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4, in the presence of PAM VU6005649 and Beta-Arrestin 1, class 1 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n91 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4, in the presence of PAM VU6005649 and Beta-Arrestin 1, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n9c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iaf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iae | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iag | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iai | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lut | | Status: | HPUB -- hold until publication | | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | | Authors: | Tsai, P.-C., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luw | | Status: | HPUB -- hold until publication | | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | | Authors: | Gu, C.K., Wang, S.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lus | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luu | | Status: | HPUB -- hold until publication | | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
