Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8rs2
Status:HPUB -- hold until publication
Title:Thaumatin measured via serial crystallography from a silicon HARE-chip.
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sihyun, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rs3
Status:HPUB -- hold until publication
Title:Thaumatin measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rsd
Status:AUTH -- processed, waiting for author review and approval
Title:Thaumatin measured via serial crystallography from a kapton HARE-chip (125 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rse
Status:HPUB -- hold until publication
Title:Proteinase K measured via serial crystallography from a silicon HARE-chip
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rsf
Status:HPUB -- hold until publication
Title:Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8y1i
Status:HOLD -- hold until a certain date
Title:Structure of guanosine-2''''-fluorinated [d(AACCGGTT)]2
Authors:Gao, R.Q., Cao, C., Tang, G.L.
Deposition date:2024-01-24
Release date:2025-01-24
PDBID:8rro
Status:HPUB -- hold until publication
Title:G12V-TCR complex with HLA-A3
Authors:Sim, M.J.W., Sun, P.D.
Deposition date:2024-01-23
PDBID:8vrp
Status:HPUB -- hold until publication
Title:HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor
Authors:Goldstone, D.C., Walsham, L.
Deposition date:2024-01-22
Sequence:

>Entity 1


PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
PDBID:8xzc
Status:HPUB -- hold until publication
Title:Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant
Authors:Chandravanshi, K., Kumar, A., Makde, R.D.
Deposition date:2024-01-21
PDBID:8rqw
Status:HPUB -- hold until publication
Title:Erk2 MAP kinase (T188E) AMP-PNP complex
Authors:Livnah, O., Gutman, D.
Deposition date:2024-01-20
PDBID:8rqx
Status:HPUB -- hold until publication
Title:Erk2 MAP kinase R65S+T188D - AMP-PNP complex
Authors:livnah, O., Gutman, D.
Deposition date:2024-01-20
PDBID:8rqv
Status:HPUB -- hold until publication
Title:Erk2 MAP kinase (T188A) AMP-PNP complex
Authors:Livnah, O., Gutman, D.
Deposition date:2024-01-19
PDBID:8vqu
Status:HPUB -- hold until publication
Title:Crystal Structure of Dehaloperoxidase B in complex with substrate 1,4-cyclohexadiene
Authors:de Seerano, V.S., Yun, D., Ghiladi, R.A.
Deposition date:2024-01-19
PDBID:8vqv
Status:HPUB -- hold until publication
Title:Structure of S. odontolytica ZTP riboswitch bound to m-1-pyridinyl-AICA
Authors:Jones, C.P., Ferre D''Amare, A.R.
Deposition date:2024-01-19
PDBID:8vqs
Status:HPUB -- hold until publication
Title:Crystal structure of Dehaloperoxidase B in complex with substrate cyclohexene
Authors:de Serrano, V.S., Yun, D., Ghiladi, R.A.
Deposition date:2024-01-19
PDBID:8vqt
Status:HPUB -- hold until publication
Title:Cryatal structure of Dehaloperoxidase B in complex with substrate 1-methyl-cyclohexene
Authors:de Serrano, V.S., Yun, D., Ghiladi, R.A.
Deposition date:2024-01-19
PDBID:8xxs
Status:HPUB -- hold until publication
Title:Crystal structure of PDE4D catalytic domain complexed with L11
Authors:Wu, D., Huang, Y.-Y., Luo, H.-B.
Deposition date:2024-01-19
PDBID:8rqi
Status:HOLD -- hold until a certain date
Title:Structure of Rhizobium NopD with ubiquitin
Authors:Reverter, D., Li, Y.
Deposition date:2024-01-18
Release date:2025-01-18
PDBID:8vqf
Status:HPUB -- hold until publication
Title:X-ray crystal structure of natural Can f 1 in complex with human IgE 1J11 Fab
Authors:Khatri, K., Ball, A., Richardson, C.M., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M.
Deposition date:2024-01-18
PDBID:8vqg
Status:HPUB -- hold until publication
Title:X-ray crystal structure of Can f 1
Authors:Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M.
Deposition date:2024-01-18
PDBID:8vq8
Status:HPUB -- hold until publication
Title:Immune receptor complex
Authors:Chaurasia, P., Littler, D.R., La Gruta, N., Rossjohn, J.
Deposition date:2024-01-17
PDBID:8xvp
Status:HPUB -- hold until publication
Title:Crystal structure of inulosucrase from Lactobacillus reuteri 121
Authors:Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W.
Deposition date:2024-01-15
PDBID:8xvq
Status:HPUB -- hold until publication
Title:Crystal structure of inulosucrase from Lactobacillus reuteri 121 in complex with fructose
Authors:Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W.
Deposition date:2024-01-15
PDBID:8xvr
Status:HPUB -- hold until publication
Title:Crystal structure of inulosucrase from Lactobacillus reuteri 121 mutant R544W
Authors:Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W.
Deposition date:2024-01-15
PDBID:8ro3
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi
Authors:Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N.
Deposition date:2024-01-11

225399

PDB entries from 2024-09-25

PDB statisticsPDBj update infoContact PDBjnumon