| PDBID: | 9q80 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9q82 | | Status: | HPUB -- hold until publication | | Title: | Recombinant spore-silk A-ENA-1 fibers | | Authors: | Sleutel, M., Sogues, A., Remaut, H. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9q81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz3 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 100-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz4 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 200-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz5 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 300-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz6 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 400-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz7 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAVELDTAATGELPVLEEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDVVSKEVTRVIDTGVFPVPAEHGNYTDPELTGPLRTTQKPISITQPEGPSFTVTGGNHIEWEKWSLDVGFDVREGVVLHNIAFRDGDRLRPIINRASIAEMVVPYGDPSPIRSWQNYFDTGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPREIRNGICMHEEDWGILAKHSDLWSGINYTRRNRRMVISFFTTIGN(2TY)DYGFYWYLYLDGTIEFEAKATGVVFTSAFPEGGSDNISQLAPGLGAPFHQHIFSARLDMAIDGFTNRVEEEDVVRQTMGPGNERGNAFSRKRTVLTRESEAVREADARTGRTWIISNPESKNRLNEPVGYKLHAHNQPTLLADPGSSIARRAAFATKDLWVTRYADDERYPTGDFVNQHSGGAGLPSYIAQDRDIDGQDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFDRSPVLDVPAN
|
|
| PDBID: | 9lz8 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz9 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lza | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzb | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzc | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzd | | Status: | HPUB -- hold until publication | | Title: | Oxidative form of copper amine oxidase from Arthrobacter globiformis determined at pH 9.0 by single-flow serial crystallography | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lze | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 500-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzf | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 1000-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyt | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Mucuna sempervirens Pathogenesis-related protein 1 | | Authors: | Zha, H.G., Fan, S.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyv | | Status: | HPUB -- hold until publication | | Title: | structure of prrx bound to DNA | | Authors: | Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form) | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
