| PDBID: | 8zdq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge complete baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnb | | Status: | HPUB -- hold until publication | | Title: | Collagen XVIII trimerization domain with introduced inter-chain disulfide bond, G(-1)C-L5C | | Authors: | Young, T., Williams, J.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zd2 | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the (CGG-dsDNA:ND=) 1:2 complex | | Authors: | Sakurabayashi, S., Furuita, K., Yamada, T., Nomura, M., Nakatani, K., Kojima, C. | | Deposition date: | 2024-05-01 | | Sequence: | >Entity 1
(DC)(DT)(DA)(DA)(DC)(DG)(DG)(DA)(DA)(DT)(DG)
>Entity 2
(DC)(DA)(DT)(DT)(DC)(DG)(DG)(DT)(DT)(DA)(DG)
|
|
| PDBID: | 9f5v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 9f64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 9f65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro-P3* (H. pylori) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
| PDBID: | 8zcp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Xenopus IgX-Fc hexamer | | Authors: | Ji, C., Zhang, R., Xiao, J. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9bla | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*086 in complex with HLA-A*24:02 presenting the NEF peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9bld | | Status: | HPUB -- hold until publication | | Title: | crystal structure of thermostable dienelactone hydrolase | | Authors: | Muniz, J.R.C., Almeida, D., Brito, V., Ciancaglini, I., Sandano, A.L.H., Squina, F., Garcia, W. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9ble | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thermostable dienelactone hydrolase. Monoclinic space group. | | Authors: | Muniz, J.R.C., Almeida, D., Brito, V., Ciancaglini, I., Sandano, A.L.H., Squina, F., Garcia, W. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9f5m | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of bacteriophage K gp155, native | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5p | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl2 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*001 in complex with HLA-B*57:03 presenting the AW10 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heme-binding protein from Populus trichocarpa | | Authors: | Kumaran, D., Grosjean, N., Blaby, E.C. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl3 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-B*57:03 presenting the AW10 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl4 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*086 in complex with HLA-B*57:03 presenting the AW10 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl5 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*001 in complex with HLA-A*24:02 presenting the TW9 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl6 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-A*24:02 presenting the TW9 peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9bl9 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-A*24:02 presenting the NEF peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9f5h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MGAT5 bump-and-hole mutant in complex with UDP and M592 | | Authors: | Liu, Y., Bineva-Todd, G., Meek, R., Mazo, L., Piniello, B., Moroz, O.V., Begum, N., Roustan, C., Tomita, S., Kjaer, S., Rovira, C., Davies, G.J., Schumann, B. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f59 | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a mammalian expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f4c | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of CKAP5/chTOG | | Authors: | Pfuhl, M. | | Deposition date: | 2024-04-27 | | Sequence: | >Entity 1
ASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRP
|
|
| PDBID: | 8zb7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbm | | Status: | HPUB -- hold until publication | | Title: | RAT skeletal muscle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8zbk | | Status: | HPUB -- hold until publication | | Title: | Mouse left ventricle ATM complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-04-26 |
|
