PDBID: | 8px6 | Status: | HPUB -- hold until publication | Title: | Hepatitis B core protein with bound SLLGRM-dimer | Authors: | Makbul, C., Khayenko, V., Maric, M.H., Bottcher, B. | Deposition date: | 2023-07-22 |
|
PDBID: | 8pwc | Status: | HPUB -- hold until publication | Title: | Crystal structure of MDM2 with BI 907828. | Authors: | Bader, G., Wolkerstorfer, B. | Deposition date: | 2023-07-20 |
|
PDBID: | 8pwk | Status: | HPUB -- hold until publication | Title: | human HINT1 in complex with compound AT8003 | Authors: | Zimberger, C., Canard, B., Ferron, F. | Deposition date: | 2023-07-20 |
|
PDBID: | 8pts | Status: | HPUB -- hold until publication | Title: | human GUK1 in complex with compound AT8001 | Authors: | Zimberger, C., Canard, B., Ferron, F. | Deposition date: | 2023-07-14 | Sequence: | >Entity 1 MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
PDBID: | 8k19 | Status: | HOLD -- hold until a certain date | Title: | Neutralization antibody ZCP3B4 bound with SARS-CoV-2 Omicron BA.5 RBD | Authors: | Tang, B., Dang, S. | Deposition date: | 2023-07-10 | Release date: | 2025-01-22 |
|
PDBID: | 8tac | Status: | HPUB -- hold until publication | Title: | Designed DNA binding protein | Authors: | Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J. | Deposition date: | 2023-06-27 |
|
PDBID: | 8pie | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human nucleoside diphosphate kinase B domain in complex with the product AT-8500 formed by catalysis of compound AT-9010 | Authors: | Feracci, M., Chazot, A., Ferron, F., Alvarez, K., Canard, B. | Deposition date: | 2023-06-21 | Release date: | 2024-12-26 |
|
PDBID: | 8jq2 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structures of a heme transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis | Authors: | Chen, X.B., Li, J. | Deposition date: | 2023-06-13 | Release date: | 2024-12-13 |
|
PDBID: | 8jq7 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structures of a heme-bound transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis | Authors: | Chen, X.B., Li, J. | Deposition date: | 2023-06-13 | Release date: | 2024-12-13 |
|
PDBID: | 8jq8 | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structures of a heme transporter bound to ATP in the heme a biosynthesis pathway of Mycobacteria tuberculosis | Authors: | Chen, X.B., Li, J. | Deposition date: | 2023-06-13 | Release date: | 2024-12-13 |
|
PDBID: | 8sw3 | Status: | HPUB -- hold until publication | Title: | BG505 GT1.1 SOSIP in complex with NHP Fabs 12C11 and RM20A3 | Authors: | Zhang, S., Torres, J.L., Ozorowski, G., Ward, A.B. | Deposition date: | 2023-05-17 | Release date: | 2024-11-16 |
|
PDBID: | 8sj6 | Status: | HPUB -- hold until publication | Title: | Ara h 2.01 38B7 8F3 | Authors: | Spiller, B.W., Shrem, R.A. | Deposition date: | 2023-04-17 | Release date: | 2024-10-17 |
|
PDBID: | 8sja | Status: | HPUB -- hold until publication | Title: | Ara H 6 13D9 16A8 | Authors: | Spiller, B.W., Shrem, R.A. | Deposition date: | 2023-04-17 | Release date: | 2024-10-17 |
|
PDBID: | 8si1 | Status: | HPUB -- hold until publication | Title: | Ara h 6 16A8 complex | Authors: | Spiller, B.W., Shrem, R.A. | Deposition date: | 2023-04-14 | Release date: | 2024-10-14 |
|
PDBID: | 8scw | Status: | HPUB -- hold until publication | Title: | Crystal structure of IRAK4-HSA complexed with BMS-986147; 6-{5-CYANO-1H-PYRAZOLO[3,4-B]PYRIDIN-1-YL}-N-[(2R)-2-FLUORROXY-3-METHYLBUTYL]-4-[(PROPAN-2-YL)AMINO]PYRIDINE-3-CARBOXAMIDE | Authors: | Muckelbauer, J.K., Ghosh, K. | Deposition date: | 2023-04-05 | Release date: | 2024-12-31 |
|
PDBID: | 8ipf | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of a DARPin protein | Authors: | Ngo, K.H., Liew, C.W., Heddi, B., Phan, A.T. | Deposition date: | 2023-03-14 | Release date: | 2024-09-18 |
|
PDBID: | 8io0 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of human HCN3 channel with cAMP | Authors: | Yu, B., Lu, Q.Y., Li, J., Zhang, J. | Deposition date: | 2023-03-10 | Release date: | 2024-08-10 |
|
PDBID: | 8io1 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of human HCN3 channel with PIP2 | Authors: | Yu, B., Lu, Q.Y., Li, J., Zhang, J. | Deposition date: | 2023-03-10 | Release date: | 2024-08-10 |
|
PDBID: | 8ikn | Status: | HOLD -- hold until a certain date | Title: | S3.11-T-box in complex with WT Mycobacterium smegmatis isoleucine tRNA | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, K., Wei, X.W., Yang, Y., Henkin, T.M., Su, Z. | Deposition date: | 2023-02-28 | Release date: | 2024-08-28 |
|
PDBID: | 8ikk | Status: | HOLD -- hold until a certain date | Title: | Mycobacterium smegmatis ileS T-box RNA in complex with its cognate tRNA | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z. | Deposition date: | 2023-02-28 | Release date: | 2024-08-28 |
|
PDBID: | 8iki | Status: | HOLD -- hold until a certain date | Title: | Mycobacterium smegmatis ileS T-box RNA in complex with acc.11-tRNA | Authors: | Jia, X., Luo, B., Su, Z. | Deposition date: | 2023-02-28 | Release date: | 2024-08-28 |
|
PDBID: | 8iko | Status: | HOLD -- hold until a certain date | Title: | S3.11-T-box in complex with acc.11-tRNA | Authors: | Jia, X., Zhang, C., Luo, B., Frandsen, J.K., Watkins, A.M., Li, K., Zhang, M., Wei, X., Yang, Y., Henkin, T.M., Su, Z. | Deposition date: | 2023-02-28 | Release date: | 2024-08-28 |
|
PDBID: | 8g4i | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | 40S ribosomal subunit of the 80S Giardia intestinalis assemblage A ribosome with Emetine bound in V1 conformation | Authors: | Eiler, D.R., Wimberly, B.T., Bilodeau, D.Y., Rissland, O.S., Kieft, J.S. | Deposition date: | 2023-02-09 |
|
PDBID: | 8g4b | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of heterodimeric Crotoxin B from Crotalus durissus collilineatus | Authors: | Salvador, G.H.M., Borges, R.J., Fontes, M.R.M. | Deposition date: | 2023-02-09 |
|
PDBID: | 8fpa | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of a chimeric antibody (Fab) fragment bound to de-N-acetyl polysialic acid (dPSA) | Authors: | Beernink, P.T., Agirre, J., Beernink, B.P., Moe, G.R. | Deposition date: | 2023-01-04 | Release date: | 2024-07-19 |
|