Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9w7q
Status:HPUB -- hold until publication
Title:SuperFi Cas9 - 20nt sgRNA - DNA ternary complex Class A
Authors:Zheng, R., Ma, L.J.
Deposition date:2025-08-06
PDBID:9w7p
Status:HPUB -- hold until publication
Title:Crystal Structure of Ledaborbactam in complex with SME-1 class A Carbapenemase
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-08-06
PDBID:9pxa
Status:HPUB -- hold until publication
Title:BG505/CH505wk4 Env chimeric SOSIP in complex with CH103 and RM19R Fabs
Authors:Cottrell, C.A., Ozorowski, G., Wu, N.R., Ward, A.B.
Deposition date:2025-08-05
PDBID:9pxe
Status:HPUB -- hold until publication
Title:JRFL.TD15 membrane Env liposome in complex with CH103.H17L8 Fab
Authors:Karlinsey, D.C., Ozorowski, G., Ward, A.B.
Deposition date:2025-08-05
PDBID:9s8j
Status:HPUB -- hold until publication
Title:Structure of protein kinase CK2alpha mutant R191Q associated with the Okur-Chung Neurodevelopmental Syndrome
Authors:Werner, C., Gast, A., Meyer, S.C., Jose, J., Niefind, K.
Deposition date:2025-08-05
PDBID:9s7u
Status:HPUB -- hold until publication
Title:X-ray structure of human glutamate carboxypeptidase II (GCPII) - the E424M inactive mutant, in complex with an inhibitor Ac-gamma-Glu-Dap(thiooxalyl)-OH
Authors:Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C.
Deposition date:2025-08-05
PDBID:9s7z
Status:HPUB -- hold until publication
Title:Structure of truncated human 60 kDa lysophospholipase at 2.73 A resolution
Authors:Rabe von Pappenheim, F., Eulig, N., Mahler, M., Tittmann, K.
Deposition date:2025-08-05
PDBID:9s7y
Status:HPUB -- hold until publication
Title:Structure of an activated, truncated human 60 kDa lysophospholipase mutant at 2.5 A resolution
Authors:Rabe von Pappenheim, F., Tittmann, K.
Deposition date:2025-08-05
PDBID:9s7r
Status:HPUB -- hold until publication
Title:Structure of the de novo protein scaffold MID1sc9_4xE
Authors:Klassen, R., Heider, A., Kugler, H., Groll, M., Zeymer, C.
Deposition date:2025-08-05
Sequence:

>Entity 1


GGMGPLAQQIKNTLTFIGQANAAGRMDEVRTLQENLEPLWEEYFQQTEGSGGSPLAQQIEYGEVLIEQARAAGRMDEVRRLSENTLQLMKEYFQQSD
PDBID:9s7x
Status:HPUB -- hold until publication
Title:Amuc0121_S1_15 in complex with D-Galactose
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s85
Status:HPUB -- hold until publication
Title:Amuc0121_S1_15 in complex with O6 sulfated D-Galactose
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s88
Status:HPUB -- hold until publication
Title:Amuc0121_S1_15 in complex with O6 sulfated Lewis A antigen (6''S-LeA)
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s8a
Status:HPUB -- hold until publication
Title:Amuc0451_S1_20
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s8f
Status:HPUB -- hold until publication
Title:Amuc1755_S1_16 in complex with D-Galactose
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s8y
Status:PROC -- to be processed
Title:Amuc1074_S1_11 in complex with N-acetyl D-glucosamine
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9s8x
Status:HPUB -- hold until publication
Title:Amuc0953_S1_20 in complex with D-Galactose
Authors:Dey, D., Cartmell, A.
Deposition date:2025-08-05
PDBID:9w6o
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, top NCP) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9w6t
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9w71
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9w6y
Status:HPUB -- hold until publication
Title:Crystal structure of L-galactose dehydrogenase from Luteolibacter sp. LG18
Authors:Koubara, K., Takenoya, M., Suzuki, M., Ito, S., Sasaki, Y., Nakamura, A., Yajima, S.
Deposition date:2025-08-05
PDBID:9w72
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9w73
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9pw3
Status:HPUB -- hold until publication
Title:Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P amyloidosis patient
Authors:Nguyen, B.A., Saelices, L.
Deposition date:2025-08-04
PDBID:9pwl
Status:AUTH -- processed, waiting for author review and approval
Title:Characterization of an archaeal Class I 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) from Methanobrevibacter ruminantium
Authors:Schofield, L., Ronimus, R., Sutherland-Smith, A.J., Carbone, V.
Deposition date:2025-08-04
PDBID:9s76
Status:HPUB -- hold until publication
Title:Structure of protein kinase CK2alpha mutant Y50C associated with the Okur-Chung Neurodevelopmental Syndrome
Authors:Werner, C., Gast, A., Jose, J., Niefind, K.
Deposition date:2025-08-04

243911

PDB entries from 2025-10-29

PDB statisticsPDBj update infoContact PDBjnumon