| PDBID: | 8py1 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 8pxe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal dimerisation domain of Hh1141 | | Authors: | Wilk, P., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMGVSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPNCPSCQKELNNIQERLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSVPFVYERNKLEHHHHHHH
|
|
| PDBID: | 8pxd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of Hh1412 | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 8pxf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the full length Hh1412 Dsb homodimer. | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 8pvy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-18 | | Release date: | 2025-01-18 |
|
| PDBID: | 8tck | | Status: | HPUB -- hold until publication | | Title: | Apo crystal Structure of modified HIV reverse transcriptase p51 domain (FPC1) | | Authors: | Pedersen, L.C., London, R.E. | | Deposition date: | 2023-07-02 |
|
| PDBID: | 8tcm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of modified HIV reverse transcriptase p51 domain (FPC1) with picric acid and Xanthene-1,3,6,8-tetrol bound | | Authors: | Pedersen, L.C., London, R.E. | | Deposition date: | 2023-07-02 |
|
| PDBID: | 8t7r | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8t5d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM studies of the interplay between uS2 ribosomal protein and leaderless mRNA during bacterial translation initiation | | Authors: | Bhattacharjee, S., Gottesman, M.E., Frank, J. | | Deposition date: | 2023-06-13 |
|
| PDBID: | 8t5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM studies of the interplay between uS2 ribosomal protein and leaderless mRNA during bacterial translation initiation | | Authors: | Bhattacharjee, S., Gottesman, M.E., Frank, J. | | Deposition date: | 2023-06-13 |
|
| PDBID: | 8t38 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Hypomethylated yeast 80S from high OD cells bound with E site tRNA from composite map | | Authors: | Zhao, Y., Li, H. | | Deposition date: | 2023-06-07 | | Release date: | 2024-12-11 |
|
| PDBID: | 8p8l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the nucleosome-bound human BCL7A | | Authors: | Martin, F., Bergamin, E. | | Deposition date: | 2023-06-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8syr | | Status: | HPUB -- hold until publication | | Title: | Rat cytosolic PEPCK in complex with GTP and beta-sulfopyruvate (273K) | | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | | Deposition date: | 2023-05-26 | | Release date: | 2024-11-20 |
|
| PDBID: | 8syy | | Status: | HPUB -- hold until publication | | Title: | Rat cytosolic PEPCK in complex with GDP and phosphoglycolic acid (253K) | | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | | Deposition date: | 2023-05-26 | | Release date: | 2024-11-20 |
|
| PDBID: | 8syz | | Status: | HPUB -- hold until publication | | Title: | Rat cytosolic PEPCK in complex with GDP and phosphoglycolic acid (273K) | | Authors: | McLeod, M.J., Barwell, S.A.E., Holyoak, T., Thorne, R.E. | | Deposition date: | 2023-05-26 | | Release date: | 2024-11-20 |
|
| PDBID: | 8p0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the open conformation of insulin-regulated aminopeptidase in complex with a small-MW inhibitor | | Authors: | Mpakali, A., Giastas, P., Stratikos, E. | | Deposition date: | 2023-05-10 | | Release date: | 2024-11-10 |
|
| PDBID: | 8owc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Hen Egg White Lysozyme co-crystallized with 10 mM TbXo4 | | Authors: | Alsalman, Z., Girard, E. | | Deposition date: | 2023-04-27 |
|
| PDBID: | 8se3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Full-length Human Protein Kinase C Beta 1 (PKCBI) in the Active Conformation | | Authors: | Cong, A.T.Q., Witter, T.L., Bruinsma, E.S., Jayaraman, S., Hawse, J.R., Goetz, M.P., Schellenberg, M.J. | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 8gdt | | Status: | HPUB -- hold until publication | | Title: | Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta Type II Receptor Extracellular Domain | | Authors: | White, S.E., Schwartze, T.A., Hinck, A.P. | | Deposition date: | 2023-03-06 | | Release date: | 2024-09-11 |
|
| PDBID: | 8gcg | | Status: | AUCO -- author corrections pending review | | Title: | MDM2 bound to inhibitor | | Authors: | Silvestri, A.P., Muir, E.W., Chakka, S.K., Tripathi, S.M., Rubin, S.M., Pye, C.R., Schwochert, J.A. | | Deposition date: | 2023-03-01 |
|
| PDBID: | 8e8n | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | GSTZ1A in conjugation with glutathione | | Authors: | McKenna, R., Combs, J.E. | | Deposition date: | 2022-08-25 |
|
| PDBID: | 7bce | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Notum Fragment 718 | | Authors: | Zhao, Y., Jones, E.Y. | | Deposition date: | 2020-12-19 |
|
| PDBID: | 4qou | | Status: | POLC -- waiting for a policy decision | | Title: | X-ray solution structure of human immunoglobulin G1 6a in PBS-137 | | Authors: | Hui, G.K., Rayner, L.E., Gor, J., Heenan, R.K., Dalby, P.A., Perkins, S.J. | | Deposition date: | 2014-06-20 |
|
| PDBID: | 4qov | | Status: | POLC -- waiting for a policy decision | | Title: | X-ray solution structure of human immunoglobulin G1 19a in PBS-137 | | Authors: | Hui, G.K., Rayner, L.E., Gor, J., Heenan, R.K., Dalby, P.A., Perkins, S.J. | | Deposition date: | 2014-06-20 |
|
