| PDBID: | 9omq | | Status: | HPUB -- hold until publication | | Title: | NSF, substrate free, hydrolyzing, class 24 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9on1 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 active state 2 (class2) | | Authors: | Villagran-Suarez, A.V. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9oms | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human acetylcholinesterase (hAChE) in complex with bis-oxime reactivator LG-1922 | | Authors: | Kovalevsky, A., Radic, Z., Gerlits, O. | | Deposition date: | 2025-05-14 | | Sequence: | >Entity 1
GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
|
|
| PDBID: | 9omt | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of paraoxon (POX)-inhibited human acetylcholinesterase (hAChE) in complex with bis-oxime reactivator LG-1922 | | Authors: | Kovalevsky, A., Radic, Z., Gerlits, O. | | Deposition date: | 2025-05-14 | | Sequence: | >Entity 1
GPLEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLD
|
|
| PDBID: | 9on8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (R) and Inositol hexakisphosphate (IP6) | | Authors: | Zadorozhnyi, R., Quinn, C.M., Zadrozny, K.K., Ablan, S.D., Kennedy, B.J., Yap, G.P.A., Sanner, D., Kraml, C., Freed, E.O., Ganser-Pornillos, B.K., Pornillos, O., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9onc | | Status: | HPUB -- hold until publication | | Title: | A-beta42-Met-R-SO amyloidal fibril - class3 | | Authors: | Chan, K.L., Boyer, D., Balasco Serrao, V.H., Raskatov, J.A. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9r79 | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-2-tetralone | | Authors: | Srinivas, K., Gilio, A.K., Grogan, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9r7a | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-(S)-2-(N-methylamino)tetralin | | Authors: | Srinivas, K., Gilio, A.K., Grogan, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9r7b | | Status: | HPUB -- hold until publication | | Title: | Structure and mechanism of the broad spectrum CRISPR-associated ring nuclease Crn4 | | Authors: | McMahon, S.A., White, M.F., Gloster, T.M. | | Deposition date: | 2025-05-14 | | Sequence: | >Entity 1
GANAMAMASLINLTPHDVTVFDGDTPIASWPASGTFARIMEDVAAPAPMDTDQGFVPVSQVRYADTVDGLPGKVSGTAYLVSRVLAAAVPRDDLYFPLDEVRDATGRIIGCRALGQFDHSHTEERGDA
|
|
| PDBID: | 9r7k | | Status: | HPUB -- hold until publication | | Title: | De novo designed enzyme for the Morita-Baylis-Hillman reaction (MBH61) | | Authors: | Tripp, A., Bijelic, A., Fischer, C., Moser, M., Oberdorfer, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9om5 | | Status: | HPUB -- hold until publication | | Title: | Composite map of six VRC35 Fabs and three MEDI8852 Fabs bound to influenza H3N2 Victoria 2011 hemagglutinin | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om1 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 active form 1 (class6) | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om2 | | Status: | HPUB -- hold until publication | | Title: | Full-length LRRK2 autoinhibited | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om6 | | Status: | HPUB -- hold until publication | | Title: | 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), 4:2:2 alphaSNAP-syntaxin-1a-SNAP-25 subcomplex local refinement, hydrolyzing, class 23 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli Adenylate kinase E114A mutant in complex with inhibitor Ap5a. | | Authors: | Mattsson, J., Rogne, P., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Odinarchaeota Adenylate kinase (OdinAK) S74G mutant | | Authors: | Rodriguez Buitrago, J.A., Schierholz, L., Mattsson, J., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9uwr | | Status: | HPUB -- hold until publication | | Title: | Pictet-Spenglerase AsKslB in complex with product of L-Trp and a-ketoglutaric acid | | Authors: | Qiao, Z., Yang, X.N., Teng, Y.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olo | | Status: | HPUB -- hold until publication | | Title: | 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 19 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a raffinose-bound D59C MelB | | Authors: | Guan, L., Hariharan, P. | | Deposition date: | 2025-05-12 | | Release date: | 2026-05-12 |
|
| PDBID: | 9olj | | Status: | HPUB -- hold until publication | | Title: | 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9r5z | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of JAK3 with GCL258 | | Authors: | Wang, G.Q., Chaikuad, A., Hillebrand, L., Gehringer, M., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-05-11 |
|
| PDBID: | 9uvj | | Status: | HPUB -- hold until publication | | Title: | Acetylphotorhaptin A, N-acetylated monocyclic daropeptide from Photorhabdus asymbiotica | | Authors: | Ma, S., Liu, Z., Zhang, Q. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9r5w | | Status: | HPUB -- hold until publication | | Title: | Structural characterisation of chromatin remodelling intermediates supports linker DNA dependent product inhibition as a mechanism for nucleosome spacing. | | Authors: | Sundaramoorthy, R., Hughes, A., Owen-hughes, T.A. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9r5x | | Status: | HPUB -- hold until publication | | Title: | Aliphatic Amidase Variant T103I | | Authors: | Salgueiro, B.A., Karmali, A., Frazao, C. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9uv8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*11:01 in complex with KRAS G12D 9-mer peptide (VVGADGVGK) | | Authors: | Jiali, Z., Linlin, Z. | | Deposition date: | 2025-05-09 |
|
