| PDBID: | 9myq | | Status: | HPUB -- hold until publication | | Title: | Mini-alphaA crystallin | | Authors: | Sroge, C.D., Padilla, M.S.T.L., Zhu, J., Martin, R.W. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i3c | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lnh | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Peroxiredoxin I in complex with compound LC-PDin20 | | Authors: | Wang, Z., Luo, C. | | Deposition date: | 2025-01-21 | | Release date: | 2026-01-21 |
|
| PDBID: | 9lnl | | Status: | PROC -- to be processed | | Title: | Crystal structure of T2R-TTL-YQVB15 complex | | Authors: | Wu, C.Y., Wang, Y.X., Chen, Q.F. | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile, a Non-nucleoside Inhibitor, with an Additional Pocket of Density | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 tetramer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy]phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9lmg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with I-Trp | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with FAD | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with Trp | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lm6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lmd | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the lasso peptide actinosynnelassin | | Authors: | Chunyang, C., Yu, W. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm4 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structrue of wuRFP-Pr1-88. | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr21 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr16-v34 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9llm | | Status: | HPUB -- hold until publication | | Title: | Structure of C-Terminal of AB40 Peptide containing GXXXG Motif in SDS Micelles | | Authors: | Sarkar, D., Bhunia, A. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lkr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22076 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9i1l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with RS-009 | | Authors: | Gray, J.L., Seupel, R., Callens, M.C., Brennan, P.E., von Delft, F. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9i1q | | Status: | HPUB -- hold until publication | | Title: | ErbB3 receptor in complex with Fab fragment of hA3 monoclonal antibody | | Authors: | Bulfaro, G., Savino, C., Costanzo, A., Fata, F., Vallone, B., Montemiglio, L.C. | | Deposition date: | 2025-01-16 |
|
