| PDBID: | 9wkp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZYG11B bound to compound 10 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wko | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 49 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkm | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZYG11B bound to compound 6 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 03 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wkn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZYG11B bound to compound 5 | | Authors: | Dong, C., Yuan, X., Li, J. | | Deposition date: | 2025-09-01 | | Release date: | 2026-09-01 |
|
| PDBID: | 9wl2 | | Status: | HPUB -- hold until publication | | Title: | NMR solution structure of LL-D49194-alpha-1 covalently bound to MYC G-quadruplex | | Authors: | Ni, X., Hu, X., Cao, C. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 9sjq | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 (pH 6.5) | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D., Salinas-Garcia, M.C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9sjp | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 bound to ANS | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D., Salinas-Garcia, M.C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9wjn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of inward-open state human norepinephrine transporter NET bound with 5648160-2 | | Authors: | Tan, J., Zang, J., Xiao, Y., Yan, C. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9wjy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tti2-Tti1-C | | Authors: | Qin, Y., Xu, G. | | Deposition date: | 2025-08-31 |
|
| PDBID: | 9y1q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alternative NBD1-binding geometry in channel-formed, ATP-bound, VX809-bound, T2a-nanobody-bound wild-type human CFTR (Composite map from PHENIX) | | Authors: | Hunt, J.F., Paige, A.S., Govaerts, C. | | Deposition date: | 2025-08-30 |
|
| PDBID: | 9y1r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a pi-class glutathione S-transferase 2 from Asc l | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-08-30 |
|
| PDBID: | 9y0x | | Status: | HOLD -- hold until a certain date | | Title: | structural basis for an ester-bond cyclase, CdnB | | Authors: | Zhao, G.X., Bewley, C. | | Deposition date: | 2025-08-29 | | Release date: | 2026-08-29 |
|
| PDBID: | 9y1m | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 in Complex with Beta-Arrestin-1 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-08-29 |
|
| PDBID: | 9wiv | | Status: | HPUB -- hold until publication | | Title: | SbSOMT in complex with SAH | | Authors: | Pow, K.C., Hao, Q. | | Deposition date: | 2025-08-29 | | Sequence: | >Entity 1
GSYDSSSSSSNDSSARNEEDESCMFALKLLGGFAVPFTIKAVIELGVMDQLLTAERAMSAEELVAAAVAAQLPRPEVACTMVDRLLRFLASHSVVRCTTEVVVGTDDATTTTCCRRSYAASPVCKWFARNGVEDSVLPLGMMILNKTFLDSWQNITDAVLEGAAPFEKTYGMPMFEYLSTNGPLNTVFHEAMANHSMIITKKLLKFFRGFEGLDVLVDVGGGNGTTLQMIRGQYKNMRGINYDLPHVIAQAAPVEGVEHVGGSMFDNIPRGNAVLLKWILHDWDDKACIKILKNCYTALHVRGKVIVLEYVVPDEPEPTLAAQGAFELDLTMLVTFGSGKERTQREFSELAMEAGFSREFKATYIFANVWALEFTK
|
|
| PDBID: | 9wiu | | Status: | HPUB -- hold until publication | | Title: | SbSOMT in apo state | | Authors: | Pow, K.C., Hao, Q. | | Deposition date: | 2025-08-29 | | Sequence: | >Entity 1
GSYDSSSSSSNDSSARNEEDESCMFALKLLGGFAVPFTIKAVIELGVMDQLLTAERAMSAEELVAAAVAAQLPRPEVACTMVDRLLRFLASHSVVRCTTEVVVGTDDATTTTCCRRSYAASPVCKWFARNGVEDSVLPLGMMILNKTFLDSWQNITDAVLEGAAPFEKTYGMPMFEYLSTNGPLNTVFHEAMANHSMIITKKLLKFFRGFEGLDVLVDVGGGNGTTLQMIRGQYKNMRGINYDLPHVIAQAAPVEGVEHVGGSMFDNIPRGNAVLLKWILHDWDDKACIKILKNCYTALHVRGKVIVLEYVVPDEPEPTLAAQGAFELDLTMLVTFGSGKERTQREFSELAMEAGFSREFKATYIFANVWALEFTK
|
|
| PDBID: | 9sie | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacterial archaellum from L. aerophila | | Authors: | Sivabalasarma, S., Taib, N., Mollat, C.L., Joest, M., Steimle, S., Gribaldo, S., Albers, S.-V. | | Deposition date: | 2025-08-28 | | Release date: | 2025-10-23 |
|
| PDBID: | 9sii | | Status: | HOLD -- hold until a certain date | | Title: | Supercoiling bacterial archaellum filament from L. aerophila | | Authors: | Sivabalasarma, S., Taib, N., Mollat, C.L., Joest, M., Steimle, S., Gribaldo, S., Albers, S.-V. | | Deposition date: | 2025-08-28 | | Release date: | 2025-10-23 | | Sequence: | >Entity 1
ITALETAIILIAFVVVASVFAFTILSAGTFSTERGKEAVYAGLSEVRSSIEIKGSVVIIGETTGATGTVDSVIFTVASAAGGEPIDLNNDPDDRVVVIDYRDATQRHTDVDWSVTWLGKNDYDTTGDTLLEQGELAEITVTLAPTITLSTNTDFIIEVKPPAGAVFSIQRTTPAYIETVNDLQ
|
|
| PDBID: | 9win | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human dihydroorotase domain complexed with 5-fluoroorotic acid | | Authors: | Huang, H.Y., Wang, M.C., Huang, C.Y. | | Deposition date: | 2025-08-28 |
|
| PDBID: | 9xza | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B Apo form | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xzb | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xzc | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 6 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xzd | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 8 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xze | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 9 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xzx | | Status: | HPUB -- hold until publication | | Title: | Staphylococcal Enterotoxin C in complex with NB C107 and NB C112 | | Authors: | Hang, W., Kim, J., Taylor, D.J., Shi, Y. | | Deposition date: | 2025-08-27 |
|
