| PDBID: | 8x8y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2660 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8r7v | | Status: | HPUB -- hold until publication | | Title: | MutSbeta bound to compound CHDI-00898647 in the canonical DNA-mismatch bound form | | Authors: | Haque, T., Brace, G., Felsenfeld, D., Tilack, K., Schaertl, S., Ballantyne, G., Maillard, M., Iyer, R., Prasad, B., Thomsen, M., Wilkionson, H., Plotnikov, N., Ritzefeld, M. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8r5l | | Status: | HPUB -- hold until publication | | Title: | E-selectin complexed with glycomimetic ligand BW850 | | Authors: | Jakob, R.P., Ernst, B., Maier, T. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8uz9 | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8uyn | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8r47 | | Status: | HPUB -- hold until publication | | Title: | AL amyloid fibril from the FOR010 light chain | | Authors: | Pfeiffer, P.B., Banerjee, S., Schmidt, M., Faendrich, M. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r46 | | Status: | WDRN -- deposition withdrawn | | Title: | AL amyloid fibril from the FOR103 light chain | | Authors: | Pfeiffer, P.B., Karimi-Farsijani, S., Kupfer, N., Schmidt, M., Faendrich, M. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxt | | Status: | HPUB -- hold until publication | | Title: | Acinetobacter baumannii Tse15 Rhs effector, toxin cleavage mutant (D1369N, D1391N) | | Authors: | Hayes, B.K., Venugopal, H., McGowan, S. | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x1y | | Status: | WDRN -- deposition withdrawn | | Title: | NMR Solution Structure of the 2:1 Coptisine-ATF4-G4 Complex | | Authors: | Xiao, C.M., Li, Y.P., Liu, Y.S., Dong, R.F., He, X.Y., Lin, Q., Zang, X., Wang, K.B., Xia, Y.Z., Kong, L.Y. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8r3j | | Status: | HOLD -- hold until a certain date | | Title: | F-actin decorated by ITPKA | | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | | Deposition date: | 2023-11-09 | | Release date: | 2024-11-09 |
|
| PDBID: | 8r3h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Phalloidin bound F-actin | | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | | Deposition date: | 2023-11-09 | | Release date: | 2024-11-09 |
|
| PDBID: | 8uxo | | Status: | HPUB -- hold until publication | | Title: | Caulobacter crescentus FljK flagellar filament (symmetrized) | | Authors: | Sanchez, J.C., Montemayor, E.J., Ploscariu, N.T., Parrell, D., Baumgardt, J.K., Yang, J.E., Sibert, B., Cai, K., Wright, E.R. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8ux6 | | Status: | HPUB -- hold until publication | | Title: | Structure of Fab B11 with a T. parva sporozoite neutralizing B cell epitope of p67 | | Authors: | Singer, A.U., Gopalsamy, A., Fellouse, F.A., Miersch, S., Sidhu, S.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8uvv | | Status: | HPUB -- hold until publication | | Title: | The NanJ sialidase catalytic domain in complex with Neu5Ac | | Authors: | Medley, B.J., Boraston, A.B. | | Deposition date: | 2023-11-04 |
|
| PDBID: | 8uvj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Etamycin bound to the 70S ribosome (focused refinement of the 50S) | | Authors: | Pichkur, E.B., Konevega, A.L. | | Deposition date: | 2023-11-03 |
|
| PDBID: | 8uvr | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with spectinomycin, mRNA, deacylated A- and E-site tRNAphe, and deacylated P-site tRNAmet at 2.60A resolution | | Authors: | Killam, B.Y., Phelps, G.A., Lee, R.E., Polikanov, Y.S. | | Deposition date: | 2023-11-03 |
|
| PDBID: | 8r2a | | Status: | HPUB -- hold until publication | | Title: | CpKRS complexed with lysine and an inhibitor | | Authors: | Dawson, A., Baragana, B., Caldwell, N. | | Deposition date: | 2023-11-03 |
|
| PDBID: | 8uvs | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with spectinomycin derivative 2694, mRNA, deacylated A- and E-site tRNAphe, and deacylated P-site tRNAmet at 2.75A resolution | | Authors: | Killam, B.Y., Phelps, G.A., Lee, R.E., Polikanov, Y.S. | | Deposition date: | 2023-11-03 |
|
| PDBID: | 8wzt | | Status: | HPUB -- hold until publication | | Title: | SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 1 microsecond after photoexcitation at RT. | | Authors: | Maity, B., Shoji, M., Luo, F., Nakane, T., Abe, S., Owada, S., Kang, J., Tono, K., Tanaka, R., Thuc, T.T., Kojima, M., Hishikawa, Y., Tanaka, J., Tian, J., Noya, H., Nakasuji, Y., Asanuma, A., Yao, X., Iwata, S., Shigeta, Y., Nango, E., Ueno, T. | | Deposition date: | 2023-11-02 |
|
