Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9bxt
Status:HPUB -- hold until publication
Title:TrxA focus-classified model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-22
PDBID:9fet
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of Human Vaccinia-related kinase 2 (VRK-2) bound to JA-47
Authors:Wang, G.Q., Amrhein, J.A., Knapp, S., Structural Genomics Consortium (SGC)
Deposition date:2024-05-21
PDBID:8zm0
Status:HOLD -- hold until a certain date
Title:A self-assembled nanofiber
Authors:Shi, J.H., Fang, Y., Ma, D., Wang, H.M.
Deposition date:2024-05-21
Release date:2025-05-21
PDBID:8zly
Status:HPUB -- hold until publication
Title:Crystal structure of Streptococcus pneumoniae pyruvate kinase in complex with oxalate and fructose 1,6-bisphosphate and UDP
Authors:Nakashima, R., Taguchi, A.
Deposition date:2024-05-21
PDBID:9bwn
Status:HPUB -- hold until publication
Title:Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis
Authors:Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R.
Deposition date:2024-05-21
PDBID:9bwa
Status:HPUB -- hold until publication
Title:Crystal structure of the Transport and Golgi Organization protein 2 Homolog (TANGO2)
Authors:Lovell, S., Cooper, A., Powers, A., Battaile, K.P., Mohsen, A.-W., Ghaloul-Gonzalez, L.
Deposition date:2024-05-21
PDBID:9bwm
Status:HPUB -- hold until publication
Title:Neutron Structure of Oxidized Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-21
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9bwq
Status:HPUB -- hold until publication
Title:X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-21
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9bwr
Status:HPUB -- hold until publication
Title:X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-21
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9feg
Status:HPUB -- hold until publication
Title:PARP15 in complex with a quinazolin-4-one inhibitor
Authors:Bosetti, C., Lehtio, L.
Deposition date:2024-05-20
PDBID:9bvy
Status:HPUB -- hold until publication
Title:Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-20
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9bvz
Status:HOLD -- hold until a certain date
Title:SARS-CoV-2 main protease bound to inhibitor AR-A-135
Authors:Liu, W.R., Blankenship, L.R.
Deposition date:2024-05-20
Release date:2025-05-20
PDBID:9bw2
Status:HPUB -- hold until publication
Title:Neutron Structure of Reduced Tyr34Phe MnSOD
Authors:Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O.
Deposition date:2024-05-20
Sequence:

>Entity 1


MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBID:9bw3
Status:HPUB -- hold until publication
Title:Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex
Authors:Xu, D., Thomas, W.C., Burnim, A.A., Ando, N.
Deposition date:2024-05-20
PDBID:8zlf
Status:HPUB -- hold until publication
Title:Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica
Authors:Gautam, A.K., Umarao, P., Gourinath, S.
Deposition date:2024-05-19
PDBID:9bv4
Status:HPUB -- hold until publication
Title:NMR Solution Structure of Excelsatoxin A in DPC micelles
Authors:Saipriyaa, P.V., Chin, Y.K., Mehdi, M.
Deposition date:2024-05-19
PDBID:9fed
Status:HPUB -- hold until publication
Title:Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41
Authors:Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D.
Deposition date:2024-05-18
PDBID:8zlc
Status:HPUB -- hold until publication
Title:Crystal Structure of Ankyrin Repeat Protein from Plasmodium falciparum
Authors:Kumari, P., Gautam, A.K., Gourinath, S., Malhotra, P.
Deposition date:2024-05-18
PDBID:9fdt
Status:HPUB -- hold until publication
Title:Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor
Authors:Friedrich, F., Einsle, O., Jung, M.
Deposition date:2024-05-17
PDBID:9fdz
Status:HPUB -- hold until publication
Title:Single particle cryo-EM structure of the multidrug efflux pump OqxB from Klebsiella pneumoniae
Authors:Lazarova, M., Frangakis, A., Pos, K.M.
Deposition date:2024-05-17
PDBID:9fdp
Status:HPUB -- hold until publication
Title:Single particle cryo-EM structure of the AcrB V612W monomer in the O state
Authors:Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M.
Deposition date:2024-05-17
PDBID:9fdq
Status:HPUB -- hold until publication
Title:Single particle cryo-EM structure of the AcrB V612F monomer in the O state
Authors:Lazarova, M., Frangakis, A., Pos, K.M.
Deposition date:2024-05-17
PDBID:9fdu
Status:HPUB -- hold until publication
Title:Crystal structure of human Sirt2 in complex with a pyridine-3-carbothioamide-based fragment inhibitor
Authors:Friedrich, F., Einsle, O., Jung, M.
Deposition date:2024-05-17
PDBID:9fdw
Status:HPUB -- hold until publication
Title:Crystal structure of human Sirt2 in complex with a 3-chlorobenzamide-based fragment inhibitor
Authors:Friedrich, F., Einsle, O., Jung, M.
Deposition date:2024-05-17
PDBID:9fdh
Status:HPUB -- hold until publication
Title:Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal
Authors:Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M.
Deposition date:2024-05-17

222926

PDB entries from 2024-07-24

PDB statisticsPDBj update infoContact PDBjnumon