PDBID: | 9rdf | Status: | HPUB -- hold until publication | Title: | Liver Pyruvate kinase in complex with a phthalazine-based fluorescent probe IV | Authors: | Nilssson, O., Brear, P., Grotli, M., Hyvonen, M. | Deposition date: | 2025-06-02 |
|
PDBID: | 9v95 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the ArlB filament of Haloarcula marismortui | Authors: | Meshcheryakov, V.A., Hyun, J., Syutkin, A.S., Pyatibratov, M.G., Wolf, M. | Deposition date: | 2025-05-30 |
|
PDBID: | 9v96 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the inner core of ArlA2 filament of Haloarcula marismortui | Authors: | Meshcheryakov, V.A., Hyun, J., Syutkin, A.S., Pyatibratov, M.G., Wolf, M. | Deposition date: | 2025-05-30 |
|
PDBID: | 9v8v | Status: | HPUB -- hold until publication | Title: | Influenza A/H5N6 polymerase symmetric dimer in pre-initiation state bound vRNA promoter | Authors: | Wang, A.J., Liao, M. | Deposition date: | 2025-05-30 |
|
PDBID: | 9v8z | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of renal amyloid fibril from an immunoglobulin light chain amyloidosis patient in polymorph A | Authors: | Zhao, K., Yu, C.Y., Ma, Y.Y., Huang, H. | Deposition date: | 2025-05-30 |
|
PDBID: | 9ovh | Status: | HPUB -- hold until publication | Title: | Structure of an ancestral ethylene forming enzyme, Anc357, in complex with Mn | Authors: | Chatterjee, S., Rankin, J.A., Farrugia, M.A., Hu, J., Hausinger, R.P. | Deposition date: | 2025-05-30 |
|
PDBID: | 9rcx | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant T127M associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-05-30 |
|
PDBID: | 9rcy | Status: | HPUB -- hold until publication | Title: | Structure of protein kinase CK2alpha mutant R21Q associated with the Okur-Chung Neurodevelopmental Syndrome | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | Deposition date: | 2025-05-30 |
|
PDBID: | 9rcw | Status: | HPUB -- hold until publication | Title: | Primed-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | Authors: | Li, C., Efremov, R.G. | Deposition date: | 2025-05-30 |
|
PDBID: | 9v8b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Influenza A/H5N6 polymerase in initiation state with bound vRNA promoter | Authors: | Wang, A.J., Liao, M. | Deposition date: | 2025-05-29 |
|
PDBID: | 9v8j | Status: | HPUB -- hold until publication | Title: | Influenza A polymerase in intermediate state with bound vRNA promoter | Authors: | Wang, A.J., Liao, M. | Deposition date: | 2025-05-29 |
|
PDBID: | 9v8k | Status: | HPUB -- hold until publication | Title: | Influenza A polymerase in Pre-initiation state with bound vRNA promoter | Authors: | Wang, A.J., Liao, M. | Deposition date: | 2025-05-29 |
|
PDBID: | 9v8o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Influenza A/H5N6 polymerase symmetric dimer in termination state bound vRNA promoter | Authors: | Wang, A.J., Liao, M. | Deposition date: | 2025-05-29 |
|
PDBID: | 9v83 | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of Asparagine Synthetase from Entamoeba histolytica | Authors: | Mishra, S., Yadav, L., Gautam, A.K., Gourinath, S. | Deposition date: | 2025-05-29 | Release date: | 2026-05-29 |
|
PDBID: | 9ovf | Status: | HPUB -- hold until publication | Title: | Rubredoxin covalently linked to benzo-18-crown-6 | Authors: | Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M. | Deposition date: | 2025-05-29 | Sequence: | >Entity 1 MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
|
|
PDBID: | 9ous | Status: | AUTH -- processed, waiting for author review and approval | Title: | D3 Virion icos | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | Deposition date: | 2025-05-29 |
|
PDBID: | 9ouq | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9our | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9oum | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029 | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9ouo | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9ov4 | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9ouz | Status: | HPUB -- hold until publication | Title: | Icosahedral D3 expanded capsid | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | Deposition date: | 2025-05-29 |
|
PDBID: | 9oun | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9oup | Status: | HPUB -- hold until publication | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA | Authors: | Sun, C., Gouaux, E. | Deposition date: | 2025-05-29 |
|
PDBID: | 9v7k | Status: | HPUB -- hold until publication | Title: | Phycobilisome allophycocyanin hexamer C from Gloeobacter violaceus PCC 7421 | Authors: | Burtseva, A.D., Baymukhametov, T.N., Slonimskiy, Y.B., Popov, V.O., Sluchanko, N.N., Boyko, K.M. | Deposition date: | 2025-05-28 |
|