| PDBID: | 9lix | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 2) - polymorph 1. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9liy | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of an AL amyloidosis patient (case 2) - polymorph 2. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9kcn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FD4-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kcp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ACI-12589-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-11-01 |
|
| PDBID: | 9kc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ZSQ07-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C. | | Deposition date: | 2024-10-31 |
|
| PDBID: | 9h8w | | Status: | HPUB -- hold until publication | | Title: | Leishmania donovani ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h6o | | Status: | HPUB -- hold until publication | | Title: | Leishmania major ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8s | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of HE30 polymorph 1 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k8t | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of HE30 polymorph 2 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9h60 | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-23 | | Sequence: | >Entity 1
MPAGMSAAAGKTLADYKAPYPKPTSRQRRYVILLDPKGDNAELNDYKVELIPGRVKLLDGANHYFLGGKIEEKTIDGWGYPYYVVTLAEMAGTAMLPLGNAAHKKLRFVPLRTSSLYRYNSKLPIVVYVPKDGVLRYRIWTAKLSGRGKAKSIKAKEM
>Entity 2
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
|
|
| PDBID: | 9k0d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 1 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0e | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 2 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0f | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 3 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
