| PDBID: | 9l65 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6e | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo3 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo1 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l3f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure-Guided Design of Picomolar-level Macrocyclic TRPC5 Channel Inhibitors with Antidepressant Activity | | Authors: | Che, T., Zhang, J., Xiong, B., Cheng, X.Y. | | Deposition date: | 2024-12-18 | | Release date: | 2025-12-18 |
|
| PDBID: | 9hh4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the family S1_19 carrageenan sulfatase ZgCgsA from Zobellia galactanivorans in complex with hybrid b-k-neocarratetraose | | Authors: | Chevenier, A., Czjzek, M., Michel, G., Ficko-Blean, E. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hh2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the family S1_19 carrageenan sulfatase ZgCgsA from Zobellia galactanivorans in complex with hybrid a-i-neocarratetraose | | Authors: | Chevenier, A., Czjzek, M., Michel, G., Ficko-Blean, E. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9h5x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human V122I transthyretin in complex with (3,4-dihydroxy-5-nitrophenyl)-(3-fluoro-5-hydroxyphenyl)methanone compound | | Authors: | Varejao, N., Pinheiro, F., Pallares, I., Ventura, S., Reverter, D. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9h5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human V30M transthyretin in complex with (3,4-dihydroxy-5-nitrophenyl)-(3-fluoro-5-hydroxyphenyl)methanone compound | | Authors: | Varejao, N., Pinheiro, F., Pallares, I., Ventura, S., Reverter, D. | | Deposition date: | 2024-10-23 |
|
| PDBID: | 9dve | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Kohinoor reversibly switchable fluorescent protein | | Authors: | Richardson, B.C., He, Y., Iuliano, J.N., Woroniecka, H.A., French, J.B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9gxh | | Status: | HPUB -- hold until publication | | Title: | Nanobody bound to TBA G-quadruplex | | Authors: | Hadzi, S., Pevec, M. | | Deposition date: | 2024-09-30 |
|
| PDBID: | 9drb | | Status: | HPUB -- hold until publication | | Title: | Binary complex of DNA polymerase iota with product DNA | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9drc | | Status: | HPUB -- hold until publication | | Title: | Ternary substrate complex of DNA polymerase iota R71A mutant with DNA (template A) and dTTP | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9dr7 | | Status: | HPUB -- hold until publication | | Title: | Product complex of DNA polymerase iota with 2 monophosphates | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9dr9 | | Status: | HPUB -- hold until publication | | Title: | Binary product complex of DNA polymerase iota with DNA | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9dqt | | Status: | HPUB -- hold until publication | | Title: | Binary substrate complex of DNA polymerase iota with DNA (template A) | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9dqu | | Status: | HPUB -- hold until publication | | Title: | Product complex of DNA polymerase iota with Pyrophosphate | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9gv4 | | Status: | HPUB -- hold until publication | | Title: | TBA G-quadruplex binding nanobody (free form) | | Authors: | Pevec, M., Hadzi, S. | | Deposition date: | 2024-09-21 | | Sequence: | >Entity 1
QVQLQESGGGLVQAGGSLRLSCAASGSRFSSNTMTWYRQAPGKQREWVATMRSIGTTRYASSVEGRFTLSRDNAKNTVYLQMNSLKPEDTAVYYCNLRRGGGIYWGQGTQVTVSSHHHHHH
|
|
| PDBID: | 9gqs | | Status: | HPUB -- hold until publication | | Title: | Teth514_1788 1,2-beta-oligomannan phosphorylase in complex with mannose (+1) and phosphate | | Authors: | Cioci, G., Durand, J., Veronese-Potocki, G., Ladeveze, S. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gph | | Status: | HPUB -- hold until publication | | Title: | Teth514_1788 1,2-beta-oligomannan phosphorylase in complex with mannose (-1) and phosphate | | Authors: | Cioci, G., Durand, J., Veronese-Potocki, G., Ladeveze, S. | | Deposition date: | 2024-09-07 |
|
| PDBID: | 9gnx | | Status: | HOLD -- hold until a certain date | | Title: | Human SENP5 in complex with SUMO1 (E67D) | | Authors: | Reverter, D., Sanchez-Alba, L., Maletic, M., Mulder, M. | | Deposition date: | 2024-09-04 | | Release date: | 2025-09-04 |
|
| PDBID: | 9gnn | | Status: | HOLD -- hold until a certain date | | Title: | Structure of SENP5 in complex with SUMO2 | | Authors: | Reverter, D., Li, Y., Sanchez-Alba, L. | | Deposition date: | 2024-09-03 | | Release date: | 2025-09-03 |
|
| PDBID: | 9ddr | | Status: | HPUB -- hold until publication | | Title: | Ternary substrate complex of DNA polymerase iota with DNA (template A), Ca2+, and dTTP | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9g6a | | Status: | HPUB -- hold until publication | | Title: | Peptide-Small Molecule Hybrids as Novel Selective Irreversible Cathepsin-K Inhibitors in Primary Osteoclasts and Human Lung Cancer Tissue | | Authors: | Turk, D., Loboda, J. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9cq0 | | Status: | HPUB -- hold until publication | | Title: | Event-based electron counting microED structure of thiostrepton from a single crystal | | Authors: | Vlahakis, N.W., Qu, S., Richards, L.S., deMoraes, L.S., Nelson, H.M., Rodriguez, J.A. | | Deposition date: | 2024-07-18 |
|
