Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9uwb
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Pictet-Spenglerase AsKslB and the compound AsKslB with L-Trp
Authors:Qiao, Z., Yang, X.N., Teng, Y.B.
Deposition date:2025-05-12
PDBID:9uwc
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Pictet-Spenglerase AsKslB and the compound AsKslB with iminium ion intermediate
Authors:Qiao, Z., Yang, X.N., Teng, Y.B.
Deposition date:2025-05-12
PDBID:9uwr
Status:HPUB -- hold until publication
Title:Pictet-Spenglerase AsKslB in complex with product of L-Trp and a-ketoglutaric acid
Authors:Qiao, Z., Yang, X.N., Teng, Y.B.
Deposition date:2025-05-12
PDBID:9r6j
Status:HPUB -- hold until publication
Title:Map of neurofibromin homotetramer with D2 symmetry (DeepEMhancer)
Authors:Shutian, S.
Deposition date:2025-05-12
PDBID:9uti
Status:AUTH -- processed, waiting for author review and approval
Title:Tetrahymena Ribozyme L-16 complex with small molecule inhibitor ZPT-01
Authors:Pan, Z.L., Ma, H.Y., Su, Z.M.
Deposition date:2025-05-04
Release date:2026-05-04
PDBID:9r21
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the flotillin-associated rhodopsin PsFAR in detergent micelle
Authors:Kovalev, K., Stetsenko, A., Marin, E., Guskov, A.
Deposition date:2025-04-29
PDBID:9r22
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the light-driven proton pump PsPR in detergent micelle
Authors:Kovalev, K., Stetsenko, A., Guskov, A.
Deposition date:2025-04-29
PDBID:9r23
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the double mutant H84V/E120G of the flotillin-associated rhodopsin PsFAR in detergent micelle
Authors:Kovalev, K., Stetsenko, A., Guskov, A.
Deposition date:2025-04-29
PDBID:9uja
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of SME-1 E166A with cefotetan
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9o84
Status:HPUB -- hold until publication
Title:Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form)
Authors:Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P.
Deposition date:2025-04-15
PDBID:9qwd
Status:HPUB -- hold until publication
Title:X-ray structure of furin (PCSK3) in complex with the biphenyl-derived compound mi2470
Authors:Dahms, S.O., Brandstetter, H.
Deposition date:2025-04-14
PDBID:9qw0
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9qw1
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9o5g
Status:HPUB -- hold until publication
Title:Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF)
Authors:Kovalevsky, A., Drago, V.N., Phillips, R.S.
Deposition date:2025-04-10
Sequence:

>Entity 1


STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
PDBID:9qu9
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (C2-symmetry)
Authors:Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J.
Deposition date:2025-04-10
PDBID:9o50
Status:HPUB -- hold until publication
Title:Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF)
Authors:Kovalevsky, A., Drago, V.N., Phillips, R.S.
Deposition date:2025-04-09
Sequence:

>Entity 1


STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
PDBID:9qt4
Status:HPUB -- hold until publication
Title:CryoEM structure of Arabidopsis TIR-NLR WRR4A tetramer in complex with effector CCG40 (focused refinement)
Authors:Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J.
Deposition date:2025-04-07
PDBID:9qsn
Status:HPUB -- hold until publication
Title:Tetrapodal ancestor of L-amino acid oxidases co-crystallized with indole-3-acetic acid
Authors:Massari, M., Mattevi, A.
Deposition date:2025-04-06
PDBID:9qso
Status:HPUB -- hold until publication
Title:Tetrapodal ancestor of L-amino acid oxidases co-crystallised with indole-3-pyruvate
Authors:Massari, M., Mattevi, A.
Deposition date:2025-04-06
PDBID:9qrt
Status:HPUB -- hold until publication
Title:FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2
Authors:Cecchini, D., Mattevi, A.
Deposition date:2025-04-04
PDBID:9qs1
Status:HPUB -- hold until publication
Title:Tetrapodal ancestor of L-amino acid oxidases
Authors:Massari, M., Mattevi, A.
Deposition date:2025-04-04
PDBID:9qr6
Status:HPUB -- hold until publication
Title:CryoEM structure of the tetrahedral M42 aminopeptidase from M. jannaschii
Authors:Atalah, J., Basbous, H., Girard, E., Effantin, E., Schoehn, G., Franzetti, B.
Deposition date:2025-04-03
PDBID:9nzm
Status:HPUB -- hold until publication
Title:Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GMPPNP and Covalently Bound to an Adduct of {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}-5,6,7,8-tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-[(2Z)-2-fluoro-3-(pyridin-2-yl)prop-2-enoyl]piperazin-2-yl}acetonitrile
Authors:Sheriff, S., Pokross, M., Witmer, M.
Deposition date:2025-04-01
PDBID:9nzn
Status:HPUB -- hold until publication
Title:Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GDP and Covalently Bound to an Adduct of (2S)-1-{4-[(7P)-7-(8-ethynyl-7-fluoro-3-hydroxynaphthalen-1-yl)-8-fluoro-2-{[(2R,4R,7aS)-2-fluorotetrahydro-1H-pyrrolizin-7a(5H)-yl]methoxy}pyrido[4,3-d]pyrimidin-4-yl]piperazin-1-yl}-2-fluoro-3-(1,3-thiazol-2-yl)propan-1-one
Authors:Sheriff, S., Pokross, M., Witmer, M.
Deposition date:2025-04-01
PDBID:9nyf
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume)
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon