| PDBID: | 9ycq | | Status: | HPUB -- hold until publication | | Title: | First Bromodomain of BRDT liganded with inhibitor GXH-IV-076 (compound 33) | | Authors: | Schonbrunn, E., Chan, A. | | Deposition date: | 2025-09-19 | | Sequence: | >Entity 1
STNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE
|
|
| PDBID: | 9spt | | Status: | PROC -- to be processed | | Title: | Structure of cis-basal conformer of human CBS induced by non-activating allosteric SAO ligand - by Helical approach | | Authors: | Inayathulla, M., Tomas, M. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9spv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | focused structure of regulatory domains of cis-basal conformer of human CBS induced by non-activating allosteric SAO ligand - by Helical approach | | Authors: | Inayathulla, M., Tomas, M. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9spw | | Status: | PROC -- to be processed | | Title: | Structure of cis-basal conformer of human CBS induced by non-activating allosteric SAO ligand - by single particle approach. | | Authors: | Inayathulla, M., Tomas, M. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9spd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | minimal tRNA ligase complex | | Authors: | Pfleiderer, M.M., Jinek, M. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9spe | | Status: | PROC -- to be processed | | Title: | minimal tRNA ligase complex bound by PYROXD1 | | Authors: | Pfleiderer, M.M., Jinek, M. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9soy | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the ancestral reconstructed Pseudomonas chemoreceptor aPcpI in complex with salicylate | | Authors: | Gavira, J.A., Rico-Jimenez, M., Ortega, A., Roca, A., Krell, T., Zhulin, I.B., Matilla, M.A. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9sou | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the ancestral reconstructed Pseudomonas chemoreceptor aPcpI in complex with citrate | | Authors: | Gavira, J.A., Matilla, M.A., Rico-Jimenez, M., Ortega, A., Roca, A., Krell, T., Zhulin, I.B. | | Deposition date: | 2025-09-15 |
|
| PDBID: | 9y8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 1 | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 7k | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 8e | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 9h | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 9e | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 9k | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 9c | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 8m | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 10j | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 10b | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 8i | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y8v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Kelch domain of human KLHL12 with compound 10q | | Authors: | Amporndanai, K., Madrigal-Carrillo, E.A., Rietz, T.A., Zhao, B., Fesik, S.W. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9snn | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the ancestral reconstructed Pseudomonas chemoreceptor aPcpI in complex with benzoate | | Authors: | Gavira, J.A., Matilla, M.A., Krell, T., Rico-Jimenez, M., Zhulin, I.B., Ortega, A., Roca, A. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9smy | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the Pseudomonas putida chemoreceptor PcpI | | Authors: | Gavira, J.A., Rico-Jimenez, M., Ortega, A., Roca, A., Krell, T., Zhulin, I.B., Matilla, M.A. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9wn1 | | Status: | HPUB -- hold until publication | | Title: | PhospholipaseA2 with a ligand | | Authors: | Zhu, D., Wang, Q. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9y53 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Ornithine Aminotransferase Soaked with CPP115 | | Authors: | Corrigan, M.C., Vargas, A.L., Kang, K.M., Silverman, R.B., Liu, D. | | Deposition date: | 2025-09-04 |
|
| PDBID: | 9sli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human PIN1 covalently bound to Z154 | | Authors: | Igashov, I., Schneuing, A., Dobbelstein, A.W., Morozova, I., Neeser, R.M., Elizarova, E., Petruzzella, A., Gampp, O., Testori, F., Ferraris, D.M., Riek, R., Schwaller, P., Bronstein, M., Correia, B. | | Deposition date: | 2025-09-04 |
|
