Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9m07
Status:HPUB -- hold until publication
Title:Histidine kinase QseE sensor domain of Salmonella Typhimurium SL1344
Authors:Gao, X., Li, G.B., Gong, P.Q.
Deposition date:2025-02-24
PDBID:9lzv
Status:HPUB -- hold until publication
Title:Crystal structure of human glutaminyl cyclase in complex with Inhibitor M-42
Authors:Li, G.-B., Meng, F.-B., Mou, J.
Deposition date:2025-02-22
PDBID:9ng1
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal structure of FabG4 from Pseudomonas putida KT2440
Authors:Andrzejewski, S.J., Friedman, A.J., Mains, K., Thompson, A., Sankaran, B., Zwart, P.H., Shirts, M.R., Fox, J.M.
Deposition date:2025-02-21
PDBID:9ne2
Status:HPUB -- hold until publication
Title:cryoEM structure of the human OGA-L Catalytic Dimer
Authors:Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A.
Deposition date:2025-02-19
PDBID:9ne4
Status:HPUB -- hold until publication
Title:cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer
Authors:Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A.
Deposition date:2025-02-19
PDBID:9ne5
Status:HPUB -- hold until publication
Title:cryoEM structure of the B-chain of the human OGA-L Catalytic Dimer
Authors:Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A.
Deposition date:2025-02-19
PDBID:9ned
Status:HPUB -- hold until publication
Title:AcA-EI-shaker with free peptide conformation B
Authors:Tan, X., Swartz, K.J.
Deposition date:2025-02-19
PDBID:9igb
Status:HPUB -- hold until publication
Title:Structure of human Bcl-xL in complex with small molecule inhibitor
Authors:Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Murray, J.B.
Deposition date:2025-02-19
PDBID:9igh
Status:HPUB -- hold until publication
Title:Structure of human Bcl-xL in complex with small molecule inhibitor
Authors:Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Davidson, J., Murray, J.B.
Deposition date:2025-02-19
PDBID:9ly6
Status:HPUB -- hold until publication
Title:antibody 20G5 (Fab'')2 in complex with human B7-H3
Authors:Li, B., Zhou, S., He, K.
Deposition date:2025-02-19
PDBID:9ncs
Status:HPUB -- hold until publication
Title:RNase A in complex with Uridine Vanadate and decavanadates
Authors:Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T.
Deposition date:2025-02-17
Sequence:

>Entity 1


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
PDBID:9nd7
Status:HPUB -- hold until publication
Title:[T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s
Authors:Lu, B., Vecchioni, S.
Deposition date:2025-02-17
PDBID:9nd6
Status:HPUB -- hold until publication
Title:[T:Ag+/Hg2+:T--(pH8-pH9.5; 50s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 50s
Authors:Lu, B., Vecchioni, S.
Deposition date:2025-02-17
PDBID:9nd8
Status:HPUB -- hold until publication
Title:[T:Ag+/Hg2+:T--(pH8-pH9.5; 95s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 95s
Authors:Lu, B., Vecchioni, S.
Deposition date:2025-02-17
PDBID:9nd9
Status:HPUB -- hold until publication
Title:[T:Ag+/Hg2+:T--(pH11-pH9.5; 5s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 5s
Authors:Lu, B., Vecchioni, S.
Deposition date:2025-02-17
PDBID:9nbr
Status:HPUB -- hold until publication
Title:DNA Ligase 1 with 3''deoxyribo-8oxoG:C nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2025-02-14
PDBID:9nbg
Status:AUTH -- processed, waiting for author review and approval
Title:H-1 Parvovirus VLP - Glycan [s(Lex)2]
Authors:Busuttil, K.B., Bennett, A.B., McKenna, R.
Deposition date:2025-02-13
PDBID:9nb3
Status:HPUB -- hold until publication
Title:Cryo-EM structure of quaternary complex of human phosphoribosylglycinamidine synthase with thioester intermediate bound (at glutaminase site) and AMPPNP and FGAR (at synthase site).
Authors:Sharma, N., French, J.B.
Deposition date:2025-02-13
PDBID:9lw0
Status:AUTH -- processed, waiting for author review and approval
Title:Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1
Authors:Cui, H.B.
Deposition date:2025-02-13
PDBID:9nal
Status:HPUB -- hold until publication
Title:Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site.
Authors:Sharma, N., French, J.B.
Deposition date:2025-02-12
PDBID:9ibh
Status:AUTH -- processed, waiting for author review and approval
Title:Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E
Authors:Paris, G., Luisi, B.F.
Deposition date:2025-02-12
PDBID:9n9w
Status:HPUB -- hold until publication
Title:Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase
Authors:Sharma, N., French, J.B.
Deposition date:2025-02-11
PDBID:9iaj
Status:HPUB -- hold until publication
Title:Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Ala acceptor arm
Authors:Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P.
Deposition date:2025-02-11
PDBID:9iak
Status:HPUB -- hold until publication
Title:Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm
Authors:Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P.
Deposition date:2025-02-11
PDBID:9ial
Status:HPUB -- hold until publication
Title:Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm
Authors:Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P.
Deposition date:2025-02-11

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon