PDBID: | 9bwp | Status: | PROC -- to be processed | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA. | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwq | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwr | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwa | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Transport and Golgi Organization protein 2 Homolog (TANGO2) | Authors: | Lovell, S., Cooper, A., Powers, A., Battaile, K.P., Mohsen, A.-W., Ghaloul-Gonzalez, L. | Deposition date: | 2024-05-21 |
|
PDBID: | 9fei | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9feg | Status: | HPUB -- hold until publication | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-05-20 |
|
PDBID: | 9fej | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlj | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, shut state) | Authors: | Chen, Q., Hu, H. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 8zlk | Status: | HPUB -- hold until publication | Title: | PWWP domain from human DNMT3B | Authors: | Cho, C.-C., Yuan, H.S. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlg | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 8zll | Status: | HPUB -- hold until publication | Title: | Apo state of hPAC | Authors: | Chen, X., Su, N. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlp | Status: | HPUB -- hold until publication | Title: | apo WT polymorph 5a alpha-synuclein fibril | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlo | Status: | HPUB -- hold until publication | Title: | F0502B-bound E46K alpha-synuclein fibril | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zli | Status: | HPUB -- hold until publication | Title: | BTA-2-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlm | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | Authors: | Qiang, C., Hongli, H. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bvi | Status: | HPUB -- hold until publication | Title: | Identification of multiple ligand hotspots on SOS2, compound 2 | Authors: | Phan, J., Fesik, S.W. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvf | Status: | HPUB -- hold until publication | Title: | Identification of multiple ligand hotspots on SOS2, compound 6 | Authors: | Phan, J., Fesik, S.W. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bve | Status: | HPUB -- hold until publication | Title: | Identification of multiple ligand hotspots on SOS2, compound 9 | Authors: | Phan, J., Fesik, S.W. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvd | Status: | HPUB -- hold until publication | Title: | Crystal structure of SRY HMG box bound to DNA | Authors: | Georgiadis, M.M. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvn | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvr | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bw7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bw6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|
PDBID: | 9bv6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-20 |
|