| PDBID: | 9wxr | | Status: | HPUB -- hold until publication | | Title: | sensory rhodopsin I with its cognate transducer HtrI | | Authors: | Lim, G.Z., Lin, Y.E., Wu, Y.M., Chen, P.C., Fu, H.Y., Yang, C.S. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srp | | Status: | HPUB -- hold until publication | | Title: | Structure of the Diels-Alderase ChlE3 in complex with cofactor FAD | | Authors: | Manzo-Ruiz, M.B., Back, C.R., Race, P.R. | | Deposition date: | 2025-09-24 |
|
| PDBID: | 9wx0 | | Status: | HPUB -- hold until publication | | Title: | AcrX13 wedges into Cas3 by mimicking Cas8 to block Cascade recruitment | | Authors: | Hu, C.Y., Zhang, S.F., Ma, S.S. | | Deposition date: | 2025-09-24 |
|
| PDBID: | 9sr2 | | Status: | HPUB -- hold until publication | | Title: | Catalytically active GH161A phosphorylase refined in C1 | | Authors: | Cooper, N., Cioci, G., Ladeveze, S., Potocki-Veronese, G., Moulis, C. | | Deposition date: | 2025-09-23 |
|
| PDBID: | 9yd7 | | Status: | HPUB -- hold until publication | | Title: | Complex of Dihydroorotase from M. jannaschii with Carbamoyl Aspartate | | Authors: | Vitali, J., Nix, J.C., Newman, H.E., Colaneri, M.J. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9wvk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human NIPBL C-terminal domain | | Authors: | Gupta, S., Roy, S. | | Deposition date: | 2025-09-20 |
|
| PDBID: | 9sqb | | Status: | HOLD -- hold until a certain date | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 in complex with benzoyl-D-arginine | | Authors: | Simon, A.H., Parthier, C., Bordusa, F., Stubbs, M.T., Schoepfel, M. | | Deposition date: | 2025-09-19 | | Release date: | 2026-09-19 |
|
| PDBID: | 9wut | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wuu | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., LIu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wuv | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wuw | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wuy | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Chen, C., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wva | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Y393A FMNH2-dependent monooxygenase | | Authors: | Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wv8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphate binding protein(PstS1) from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9yc7 | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3k (MIPS3415) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9yc5 | | Status: | HPUB -- hold until publication | | Title: | Human uPAR bound to the Fab fragment of targeted cancer therapeutic antibody FL1 | | Authors: | Anane, R.F., Whisstock, J.C., Engelholm, L.H., Law, R.H.P., Ploug, M. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9yc6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mutant human uPAR bound to the Fab fragment of the targeted cancer therapeutic antibody FL1 | | Authors: | Anane, R.F., Whisstock, J.C., Engelholm, L.H., Law, R.H.P., Ploug, M. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wus | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of the Periplasmic Domain of AAA Protease FtsH | | Authors: | Kabasakal, B.V., Goc, G., Yadav, S., Borucu, U., Berger, I., Schaffitzel, C. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wuj | | Status: | HPUB -- hold until publication | | Title: | Diguanylate cyclase Q15Z91 complex with c-di-GMP and citrate | | Authors: | Han, L., Silvaggi, N.R. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9spl | | Status: | HOLD -- hold until a certain date | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 | | Authors: | Schoepfel, M., Parthier, C., Bordusa, F., Stubbs, M.T., Simon, A.H. | | Deposition date: | 2025-09-17 | | Release date: | 2026-09-17 |
|
| PDBID: | 9yc0 | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3ab (MIPS3413) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9ybo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma cruzi cruzain in complex with boceprevir | | Authors: | Ferreira, P.R., Muniz, J.R.C. | | Deposition date: | 2025-09-17 | | Sequence: | >Entity 1 APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
|
|
| PDBID: | 9wu2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cZ22-Fab in complex with left-handed dC(GC)3 DNA | | Authors: | Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9spc | | Status: | HPUB -- hold until publication | | Title: | Recombinant human butyrylcholinesterase in complex with ethyl 1-[3-(2-oxopyrrolidin-1-yl)propyl]-2-phenyl-1H-1,3-benzodiazole-5-carboxylate | | Authors: | Brazzolotto, X., Ha, Z.Y., Law, C.S.W., Yeong, K.Y. | | Deposition date: | 2025-09-16 |
|