| PDBID: | 9bzi | | Status: | HPUB -- hold until publication | | Title: | Class 31 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzj | | Status: | HPUB -- hold until publication | | Title: | Class 40 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzl | | Status: | HPUB -- hold until publication | | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | | Deposition date: | 2024-05-24 | | Sequence: | >Entity 1
GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
|
|
| PDBID: | 9bzk | | Status: | HPUB -- hold until publication | | Title: | Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzm | | Status: | HPUB -- hold until publication | | Title: | Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzo | | Status: | HPUB -- hold until publication | | Title: | Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c0a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Effect of glutathione on the stability, dynamics and catalysis of two different classes of glutathione transferases from Taenia solium | | Authors: | Miranda-Blancas, R., Sanchez-Juarez, C., Sanchez-Perez, L., Zubillaga, R., Flores-Lopez, R., Landa, A., Miranda-Blancas, R., Garcia-Gutierrez, P., Rudino-Pinera, E. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9byx | | Status: | HPUB -- hold until publication | | Title: | Class 8 model for turnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9ffj | | Status: | HPUB -- hold until publication | | Title: | Artificial metalloenzyme with a nickel-based 1,10-phenanthroline cofactor and streptavidin N49M-S112V mutant | | Authors: | Lau, K., Wang, W., Pojer, F., Larabi, A. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9ffd | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF ALDO-KETO REDUCTASE 1C3 (AKR1C3) IN COMPLEX WITH AN INHIBITOR MEDS765 | | Authors: | Frydenvang, K., Hussain, S., Mirza, O.A. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9ffk | | Status: | HOLD -- hold until a certain date | | Title: | Eugenol hydroxylase from Novosphingobium sp in complex with vanillyl alcohol | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-05-23 | | Release date: | 2025-05-23 |
|
| PDBID: | 9fge | | Status: | HOLD -- hold until a certain date | | Title: | Eugenol hydroxylase from Novosphingobium sp: T181D mutant in complex with vanillin | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-05-23 | | Release date: | 2025-05-23 |
|
| PDBID: | 9by5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of RT-PhyR (ruthe_01174) | | Authors: | Swingle, D., Isiorho, E.A., Gardner, K.H. | | Deposition date: | 2024-05-23 | | Sequence: | >Entity 1
EFMSTTDAPDLSAQIAAELPYLRRYARALTGSQSSGDAYALATLEAILDEPALFETGTTPRVALFTVFHTIWNSSGSPVSDGETGLARAAQRHLARLTPNTREALLLSTIEDFTPEEVATIMRSDVDEVRHLINRARSEMEDSVSGRVMIIEDEAIIALDLQTIVADMGHAITGVARTRDAAVALAGIEKPDLILADIQLADRSSGIDAVNEILRARGDIPVIFITAFPERLLTGERPEPAFLISKPYREDQVRSAISQAMFFASTEPLKA
|
|
| PDBID: | 9byj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Hck in complex with the Src-family kinase inhibitor A-419259 | | Authors: | Selzer, A.M., Alvarado, J.J., Smithgall, T.E. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9bye | | Status: | HPUB -- hold until publication | | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant E.coli Ferritin ECFTNA | | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Harshbarger, W., Delany, I., Cozzi, R. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9bxw | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-115 | | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9bxx | | Status: | HPUB -- hold until publication | | Title: | Class 11 model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9bxy | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-117 | | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9bxz | | Status: | HPUB -- hold until publication | | Title: | Class 15 model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by0 | | Status: | HPUB -- hold until publication | | Title: | Class 16 model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by1 | | Status: | HPUB -- hold until publication | | Title: | Consensus model for product condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by3 | | Status: | HPUB -- hold until publication | | Title: | Class 3 model for product condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by7 | | Status: | HPUB -- hold until publication | | Title: | Class 8 model for product condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by4 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of the kinase domain of EGFR with non-covalent osimertinib | | Authors: | Ashtekar, K.D., Stayrook, S.E., Lemmon, M.A. | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9by6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the kinase domain of EGFR soaked with non-covalent osimertinib | | Authors: | Ashtekar, K.D., Stayrook, S.E., Lemmon, M.A. | | Deposition date: | 2024-05-23 |
|
