| PDBID: | 9wsn | | Status: | HPUB -- hold until publication | | Title: | Tetramer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-09-13 |
|
| PDBID: | 9ws4 | | Status: | HPUB -- hold until publication | | Title: | Cyro-EM structure of the ACT-451840-bound PfMDR1 | | Authors: | Zhao, Z., Li, J., Wang, X., Liu, X., Wang, N., Xu, H., Quan, C., Wang, X., Kato, N., Deng, D., Jing, X. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9wrn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric anti-Z-DNA Fab cZ22-Fab | | Authors: | Lee, C.C., Hsu, S.F., Wang, A.H.J. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9ws0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cZ22-Fab in complex with left-handed d(CG)6 DNA | | Authors: | Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free full-length Tau P301S fibrils | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsa | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 1 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsb | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 2 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9y7v | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT bound to coenzyme A in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y7y | | Status: | HPUB -- hold until publication | | Title: | KRAS-specific 24-246 TCR in complex with HLA-C*01:02 presenting KRAS G12V 9mer peptide (11-AVGVGKSAL-19) | | Authors: | Miller, H.A., Palowitch, G.M., Dulberger, C.L. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZER1 bound to MHGD degron | | Authors: | Dong, C., Ma, J., Li, J. | | Deposition date: | 2025-09-11 | | Release date: | 2026-09-11 |
|
| PDBID: | 9sn9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry in complex with glutathione | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from poplar in complex with quercetin | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
VVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLINLAGF
|
|
| PDBID: | 9y79 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC^walked) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Shandilya, S., Wang, C., Molodtsov, V., Ebright, R.H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6t | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y72 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a two-hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6o | | Status: | HPUB -- hold until publication | | Title: | Structure of fimbriae-like lipoprotein by Cryo Electron Microscopy | | Authors: | Hanssen, E., Gorasia, D.G., Reynolds, E.C. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9wpb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin (TTR) with pryazole-based stabilizer | | Authors: | Choe, J., Choi, S., Shin, H.-C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y68 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 (G2019S) after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y67 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y65 | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum M1 aminopeptidase (PfA-M1) bound to inhibitor 3k (MIPS3415) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphate binding protein from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphate binding protein(SphX) from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp6 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Zea mays GLN1 | | Authors: | Wu, X.X., Cheng, Y.Q., Zhang, Y., Huang, Y.C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9woy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | rystal Structure of the MLH1 Protein Bound to the FAN1 Peptide (145-163) | | Authors: | Chen, Y.C., Liu, Y.L., Shang, X.C. | | Deposition date: | 2025-09-07 |
|
