| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
| PDBID: | 9frl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fra | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-MAP leaderless mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9frc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Architectural insights into spatially distinct corrin and metal binding sites of CobN | | Authors: | Pickersgill, R.W., Brown, D.G., Ladakis, D., Warren, M.J. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9frd | | Status: | HPUB -- hold until publication | | Title: | Wildtype EGFR bound with Compound 23 | | Authors: | Pagliarini, A.R., Milgram, B.C., Borrelli, D.R., OHearn, E., Huff, M.R., Ladd, B., Brooijmans, N., Henderson, J.A., Hilbert, B.J., Wang, W., Ito, T. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8zyy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 3) | | Authors: | Sun, D., Li, X., Yuan, Q., Yin, W., Xu, H.E., Tian, C. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9cb6 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of RT-PhyR (ruthe_02744) | | Authors: | Swingle, D., Isiorho, E.A., Gardner, K.H. | | Deposition date: | 2024-06-18 | | Sequence: | >Entity 1
GEFMPQTFADAVAASLPHLRRYARALTGEQRTGDAIAARTLEGLIADPSVLERDLEPRLMLFRAFHRTWRREGAPVGEADSHLAQRAQSHLARLTPNTREALLLHAIEGFTAQEIGAVMEVPPETAADFIDTALREMAESVAGRVMIIEDEAIIAMDIAAIVREMGHRVTGIARTRFEAVRLAREERPDLILADIQLADNSSGIDAVNEILAEFADLPVIFITAFPERLLTGERPEPAFLITKPYREEQVRSAVSQAMFFASTETLAA
|
|
| PDBID: | 9fqt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the arginine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the lysine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the ornithine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8zyi | | Status: | HPUB -- hold until publication | | Title: | crystal structure of GH57 family amylopullulanase mutant D352N from Aquifex aeolicus in complex wih 6-alpha-D-maltotriosyl-maltotriose | | Authors: | Zhu, Z.M., Wang, W.W., Yu, F. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9ca6 | | Status: | HPUB -- hold until publication | | Title: | Rns Pocket Mutant - I14F/I17F | | Authors: | Tolbert, J.D., Midgett, C.R., Kull, F.J. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9c9j | | Status: | HPUB -- hold until publication | | Title: | Atomic structure of Vibrio cholerae VopM/F-actin complex by cryo-EM | | Authors: | Niedzialkowska, E., Dong, S., Kudryashova, E., Kudryashov, D., Egelman, E.H. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9c9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH in complex with nickel and succinate | | Authors: | Wanniarachchi, T.N., Bruner, S.D. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9fp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 9fpp | | Status: | HPUB -- hold until publication | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis with cofactor F420 crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 9c8i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of EV-D68 B3 Inactivated Virus Particle | | Authors: | Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9c8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of EV-D68 B3 A-Particle | | Authors: | Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9c8g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of EV-D68 A2 Inactivated Virus Particle | | Authors: | Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9c8h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of EV-D68 A2 A-Particle | | Authors: | Cheng, J., Krug, P.W., Lei, H., Moss, D.L., Huang, R., Lang, Z.C., Morton, A.J., Shen, C., Pierson, T.C., Zhou, T., Ruckwardt, T.J., Kwong, P.D. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9c7x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 antibody 1H06 in complex with a HR2 peptide | | Authors: | Van Wazer, D.J., Zhou, T., Kwong, P.D. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 9c7z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hallucinated C3 protein assembly HALC3_919 | | Authors: | Ragotte, R., Bera, A., Milles, L.F., Wicky, B.I.M., Baker, D. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8zuw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Bacteroides thetaiotaomicron glutamate decarboxylase | | Authors: | Liu, S., Yulu, W., Guoming, D., Boting, W., Xin, F. | | Deposition date: | 2024-06-10 |
|
| PDBID: | 9c77 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in cA4 bound form with ATP. | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-10 |
|
