| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsa | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-1 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qro | | Status: | HPUB -- hold until publication | | Title: | HINT1 complexed with GS-441524-MP | | Authors: | Zimberger, C., Ferron, F. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
| PDBID: | 9qrq | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9ubs | | Status: | HPUB -- hold until publication | | Title: | The structure of the AglA_T220R-Arg complex | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9ubt | | Status: | HPUB -- hold until publication | | Title: | The structure of the AglA-Ampn-Arg complex | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o18 | | Status: | HPUB -- hold until publication | | Title: | Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9qr4 | | Status: | HPUB -- hold until publication | | Title: | InlB392_T336Y: T336Y variant of Listeria monocytogenes InlB (internalin B) residues 36-392 | | Authors: | Geerds, C., Niemann, H.H. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9ub2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DHODH in complex with inhibitor 006 | | Authors: | Jun, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z., Jin, H. | | Deposition date: | 2025-04-02 | | Release date: | 2026-04-02 |
|
| PDBID: | 9ub9 | | Status: | HPUB -- hold until publication | | Title: | Wild-type Bacillus megaterium Penicillin G Acylase | | Authors: | Kaewsasan, C., Rojviriya, C., Yuvaniyama, J. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9ub3 | | Status: | HPUB -- hold until publication | | Title: | The structure of the apo-AglA from Streptomyces monomycini | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9ub5 | | Status: | HPUB -- hold until publication | | Title: | The structure of the AglA-Arg complex | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9uba | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of the AglA_K196R-Arg complex | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9ubb | | Status: | HPUB -- hold until publication | | Title: | The structure of the AglA_K225E-Arg complex | | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qr3 | | Status: | HPUB -- hold until publication | | Title: | Methyl-coenzyme M reductase of an ANME-2c from a microbial enrichment | | Authors: | Mueller, M.-C., Wagner, T. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Methyl-coenzyme M reductase of ANME-2d Candidatus Methanoperedens Vercelli Strain 1 from a bioreactor enrichment culture | | Authors: | Mueller, M.-C., Wagner, T. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qr1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Methyl-coenzyme M reductase of ANME-2d Candidatus Methanoperedens sp. BLZ2 from a bioreactor enrichment culture | | Authors: | Mueller, M.-C., Wagner, T. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9uay | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CmnI | | Authors: | Hsiao, P.Y., Chang, C.Y., Peng, C.Y. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9o02 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfOgg1-K122S mutant bound to 8-OG DNA duplex in an intermediate state | | Authors: | Huffman, J.L., Syed, A., Tang, H.Y.H., Arvai, A.S., Mol, C.D., Tainer, J.A. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9o03 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfOgg1:8OG-DNA duplex in a product-bound state | | Authors: | Arvai, A.S., Syed, A., Huffman, J.L., Mol, C.D., Hitomi, K., Tainer, J.A. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qql | | Status: | HPUB -- hold until publication | | Title: | Mouse RPS15 P131 Mutant Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqj | | Status: | HPUB -- hold until publication | | Title: | ERK2 with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqp | | Status: | AUCO -- author corrections pending review | | Title: | Mouse Ribosome rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state | | Authors: | Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
