| PDBID: | 9q9c | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9d | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D04 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9g | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D10 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nhy | | Status: | HPUB -- hold until publication | | Title: | Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni1 | | Status: | HPUB -- hold until publication | | Title: | Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni2 | | Status: | HPUB -- hold until publication | | Title: | Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9q8t | | Status: | HPUB -- hold until publication | | Title: | Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel | | Authors: | Meudal, H., Landon, C. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8q | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment E03 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8s | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment A11 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8x | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 bound to a 153 bp H2AX nucleosome | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhi | | Status: | HPUB -- hold until publication | | Title: | AMC016 v4.2 in complex with Base-C pAb isolated from animal RQk18 at week 43 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 | | Sequence: | >Entity 1
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
>Entity 2
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)F(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
>Entity 3
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARAEEELWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHCCVPTDPSPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLGNATDAINRNTTDAPNSTLRTMEEKGEIKNCSFNITTSVRDKMQKEYATFYKLDIVPIDNDNNSYRLINCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENFTDNGKTIIVQLNESVEINCTRPNNNTRKSIHIGPGRAFYTTGQIIGNIRQAHCNISRAKWNNTLHKIVKKLREQFRNKTIVFKQSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWYGNESSDNPGVEGNITLPCRIKQIINLWQEVGKAMYAPPIGGQIRCSSNITGLLLTRDGGNNNITTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKCKRRVVQRRRRRR
>Entity 4
AVGIGAVFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQSNLLRAPECQQHLLKDTHWGIKQLQARVLAVEHYLKDQQLLGIWGCSGKLICTTAVPWNATWSNKTLDNIWNNMTWMEWEKEISNYTNLIYNLIEESQNQQEKNETENLTLC
|
|
| PDBID: | 9lyv | | Status: | HPUB -- hold until publication | | Title: | structure of prrx bound to DNA | | Authors: | Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form) | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyx | | Status: | HPUB -- hold until publication | | Title: | hCTPS1 with CTP and DON | | Authors: | Guo, C.J., Bao, X.J., Liu, J.L. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
|
|
| PDBID: | 9lyy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl. | | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihg | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment C02 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihi | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment D02 and CX-4945 (Silmitasertib) | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nfk | | Status: | HPUB -- hold until publication | | Title: | Tuna P-glycoprotein Apo Conformation 3 | | Authors: | Young, M.A., Rees, S.D., Nicklisch, S.C.T., Stowell, M., Hamdoun, A., Chang, G. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nfl | | Status: | HPUB -- hold until publication | | Title: | Tuna P-glycoprotein Apo Conformation 4 | | Authors: | Young, M.A., Rees, S.D., Nicklisch, S.C.T., Stowell, M., Hamdoun, A., Chang, G. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nfm | | Status: | HPUB -- hold until publication | | Title: | Tuna P-glycoprotein bound to DDT | | Authors: | Young, M.A., Rees, S.D., Nicklisch, S.C.T., Stowell, M., Hamdoun, A., Chang, G. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nfj | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Tuna P-glycoprotein Apo Conformation 2 | | Authors: | Young, M.A., Rees, S.D., Nicklisch, S.C.T., Stowell, M., Hamdoun, A., Chang, G. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lyn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The electron diffraction structure of photosensitizer protein PSP2 | | Authors: | Zhao, Y.M., Qi, C. | | Deposition date: | 2025-02-20 |
|
