| PDBID: | 9b0a | | Status: | HPUB -- hold until publication | | Title: | GA10 nanobody bound to 2C7 peptide mimitope of Neisseria gonorrhoeae lipooligosaccharide | | Authors: | Williamson, A., Walker, E., Kelton, W., Hicks, J. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9b00 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with berberine analog of chloramphenicol CAM-BER, mRNA, deacylated A- and E-site tRNAphe, and deacylated P-site tRNAmet at 2.80A resolution | | Authors: | Batool, Z., Pavlova, J.A., Paranjpe, M.N., Tereshchenkov, A.G., Lukianov, D.A., Osterman, I.A., Bogdanov, A.A., Sumbatyan, N.V., Polikanov, Y.S. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8s8p | | Status: | HPUB -- hold until publication | | Title: | Restriction on Ku Inward Translocation Caps Telomere Ends | | Authors: | Mattarocci, S., Baconnais, S., Roisne-Hamelin, F., Pobiega, S., Alibert, O., Morin, V., Deshayes, A., Veaute, X., Ropars, V., Mazon, G., Busso, D., Fernandez Varela, P., Le Cam, E., Charbonnier, J., Cuniasse, P., Marcand, S. | | Deposition date: | 2024-03-07 |
|
| PDBID: | 8s82 | | Status: | HPUB -- hold until publication | | Title: | Restriction on Ku Inward Translocation Caps Telomere Ends | | Authors: | Mattarocci, S., Baconnais, S., Roisne-Hamelin, F., Pobiega, S., Alibert, O., Morin, V., Deshayes, A., Veaute, X., Ropars, V., Mazon, G., Busso, D., Fernandez Varela, P., Le Cam, E., Charbonnier, J., Cuniasse, P., Marcand, S. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9aw5 | | Status: | HPUB -- hold until publication | | Title: | Yeast 20S proteasome soaked with MA9 fraction E/F | | Authors: | Meneghello, R., Rustiguel, J.K., Fernandes, A.Z.N., Trivella, D.B.B. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9avv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bovine adult muscle nAChR resting state | | Authors: | Li, H., Hibbs, R.E. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9awk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bovine fetal muscle nAChR resting state | | Authors: | Li, H., Hibbs, R.E. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9awj | | Status: | HPUB -- hold until publication | | Title: | Bovine adult muscle nAChR bound to ACh | | Authors: | Li, H., Hibbs, R.E. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9avu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bovine fetal muscle nAChR bound to ACh | | Authors: | Li, H., Hibbs, R.E. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8s7m | | Status: | HPUB -- hold until publication | | Title: | RosC(R33A) - riboflavin complex | | Authors: | Ermler, U., Mack, M., Warkentin, E. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8yjo | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli glycyl radical enzyme PflD with bound malonate | | Authors: | Xue, B., Wei, Y., Robinson, R.C., Yew, W.S., Zhang, Y. | | Deposition date: | 2024-03-02 |
|
| PDBID: | 8yjn | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli glycyl radical enzyme YbiW with bound glycerol | | Authors: | Xue, B., Wei, Y., Robinson, R.C., Yew, W.S., Zhang, Y. | | Deposition date: | 2024-03-02 |
|
| PDBID: | 8yjs | | Status: | HPUB -- hold until publication | | Title: | endogenous state E PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-02 |
|
| PDBID: | 9av1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | | Authors: | Harris, S.F., Wu, P. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 9aug | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3.G57R | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9auh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9aui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yhn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cytochrome P450 107P2 from streptomyces avermitilis | | Authors: | Jeong, E.S., Kim, V.C., Kim, C.M., Lee, Y.B. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6q | | Status: | HPUB -- hold until publication | | Title: | RosC | | Authors: | Ermler, U., Warkentin, E., Demmer, U., Mack, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6y | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of TEAD1 with OPN-9652 | | Authors: | Aplin, A.E. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6w | | Status: | HPUB -- hold until publication | | Title: | Small circular RNA dimer | | Authors: | McRae, E.K., Kristoffersen, E.L., Holliger, P., Andersen, E.S. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 9au7 | | Status: | HPUB -- hold until publication | | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | | Deposition date: | 2024-02-28 |
|
