| PDBID: | 9nyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nye | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nym | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 allosteric loop mutant, N448A | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qoh | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qog | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 in complex with a a double-helical aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Sachs, J., Merlet, E., Ferrand, Y., Huc, I. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoq | | Status: | HPUB -- hold until publication | | Title: | Leishmania donovani ISP2 in complex with bovine trypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u77 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Glycogen branching enzyme (VvGBE) from Vibrio vulnificus MO6-24/O | | Authors: | An, Y., Lee, S.J., Park, J.T., Woo, E.J. | | Deposition date: | 2025-03-24 | | Sequence: | >Entity 1
MRIVFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPFIDPTQGALRVWMPGATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWNGVEQLIDDPYQYHGIYAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHATAVSLVGCFNDWDGRRHPMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHARYQWQDAQWQTRPVTEKRKEALSFYELHAGSWKRNEQGEFLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDLGREQVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLDYSRSHGQWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLVYAHSENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYFGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLDFPRHQGVQALTRDLNHLYRNEAALHDQDCIPAGFEWRLQDAAEQSIIAHERISEAGERILVVSNFTPVPRDEFRLGVPNKGRYQLLLNTDDSKYAGSGYEVVVDAKSEAVVSEDLAQSIVLRLPPLSTLFYKLV
|
|
| PDBID: | 9nwt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of DDB1dB:CRBN:mezigdomide:SALL4(392-449;G416A) | | Authors: | Park, J., Hunkeler, M., Roy Burman, S.S., Fischer, E.S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9u5v | | Status: | HPUB -- hold until publication | | Title: | Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with LC) | | Authors: | Nikolaev, A., Markeeva, E., Remeeva, A., Borshchevsky, V., Gushchin, I. | | Deposition date: | 2025-03-22 |
|
| PDBID: | 9u5n | | Status: | HPUB -- hold until publication | | Title: | Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with FMN) | | Authors: | Nikolaev, A., Markeeva, E., Kovalev, K., Gushchin, I. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP204 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S-nitrosylated triose phosphate isomerase from Chlamydomonas reinhardtii | | Authors: | Fanti, S., Fermani, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-03-21 | | Sequence: | >Entity 1
ASSAKFFVGGNWK(SNC)NGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9nv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP207 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP101 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nva | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP105 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP203 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql0 | | Status: | HOLD -- hold until a certain date | | Title: | E. coli IspH crystallized in the presence of adenosine hemisulfate | | Authors: | Bikbaev, K., Dormann, C., Span, I. | | Deposition date: | 2025-03-20 | | Release date: | 2026-03-20 |
|
| PDBID: | 9nui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2a from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nul | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
