PDBID: | 9qux | Status: | HPUB -- hold until publication | Title: | Solution structure of the Homer1 EVH1 domain | Authors: | Czajlik, A., Maruzs, B., Fanni, F., Batta, G., Gaspari, Z., Peterfia, B.F. | Deposition date: | 2025-04-11 | Sequence: | >Entity 1 GSHMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQ
|
|
PDBID: | 9ufo | Status: | HOLD -- hold until a certain date | Title: | Structure of the asymmetrically reconstructed phage T4 capsid-neck-tail complex | Authors: | Shao, Q., Dong, J., Wang, A., Li, L., Zheng, Y., Li, H., Li, Y., Zhang, Q., Sun, L., Fokine, A., Rao, V.B., Tao, P., Fang, Q. | Deposition date: | 2025-04-10 | Release date: | 2026-04-10 |
|
PDBID: | 9ufi | Status: | HPUB -- hold until publication | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP and FSA | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | Deposition date: | 2025-04-10 |
|
PDBID: | 9ufc | Status: | HOLD -- hold until a certain date | Title: | Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum | Authors: | Zhao, H.B., Fan, S.L. | Deposition date: | 2025-04-10 | Release date: | 2026-04-10 |
|
PDBID: | 9uf7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o5p | Status: | HPUB -- hold until publication | Title: | Structure of ClpC1-NTD complexed with Diterpene B (GRDN0001) | Authors: | Ratia, K., Lee, H., Abad-Zapatero, C. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o61 | Status: | HPUB -- hold until publication | Title: | R-phycoerythrin | Authors: | Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o60 | Status: | HPUB -- hold until publication | Title: | Local refinement of 1C5H TCR bound to R-phycoerythrin (gamma chain dimer) | Authors: | Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o62 | Status: | HPUB -- hold until publication | Title: | 1C5H TCR bound to R-phycoerythrin | Authors: | Rashleigh, L., Venugopal, H., Rossjohn, J., Gully, B.S. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o5j | Status: | HPUB -- hold until publication | Title: | Human Aconitate Decarboxylase I apo form | Authors: | Runge, B.R., Monteiro, D.C.F. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o5n | Status: | HPUB -- hold until publication | Title: | Human Aconitate Decarboxylase I bound to citraconate | Authors: | Runge, B.R., Monteiro, D.C.F. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o5r | Status: | HPUB -- hold until publication | Title: | VAR2CSA in complex with V2C.044 Fab | Authors: | Raghavan, S.S.R., Ward, A.B. | Deposition date: | 2025-04-10 |
|
PDBID: | 9o5b | Status: | AUTH -- processed, waiting for author review and approval | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | Deposition date: | 2025-04-09 |
|
PDBID: | 9ue4 | Status: | HPUB -- hold until publication | Title: | Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB3-2 | Authors: | Li, G.-B., Wei, S.-Q. | Deposition date: | 2025-04-08 |
|
PDBID: | 9ueh | Status: | HPUB -- hold until publication | Title: | Serine Beta-Lactamase OXA-48 in Complex with MBL/SBL Inhibitor FB1-10 | Authors: | Li, G.-B., Wei, S.-Q. | Deposition date: | 2025-04-08 |
|
PDBID: | 9uem | Status: | HPUB -- hold until publication | Title: | Metallo-Beta-Lactamase VIM-2 in Complex with MBL/SBL Inhibitor FB1-12 | Authors: | Li, G.-B., Wei, S.-Q. | Deposition date: | 2025-04-08 |
|
PDBID: | 9o4v | Status: | AUTH -- processed, waiting for author review and approval | Title: | RNase A in complex with Pseudouridine Vanadate and decavanadates | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qtg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qte | Status: | HPUB -- hold until publication | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qtf | Status: | HPUB -- hold until publication | Title: | Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | Deposition date: | 2025-04-08 |
|
PDBID: | 9qsw | Status: | HPUB -- hold until publication | Title: | Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid | Authors: | Mokos, D., Daniel, B. | Deposition date: | 2025-04-07 |
|
PDBID: | 9ud7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human glutaminyl cyclase in complex with Inhibitor CL7 | Authors: | Li, G.-B., Ning, X.-L., Meng, F.-B., Chen, Y.-T. | Deposition date: | 2025-04-06 |
|
PDBID: | 9qsm | Status: | HPUB -- hold until publication | Title: | small molecule inhibitor in complex with PD-L1 | Authors: | Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E. | Deposition date: | 2025-04-05 |
|
PDBID: | 9qs4 | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qrq | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|