| PDBID: | 9cms | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (E166V) in complex with ensitrelvir (ESV) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9cmu | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (L50F, E166V) in complex with ensitrelvir (ESV) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMFNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9cmc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 2 with two human derived Fab antibodies 22S1 and 23P34 | | Authors: | Pedersen, L.C., Mueller, G.A., Min, J. | | Deposition date: | 2024-07-14 |
|
| PDBID: | 9g44 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the minimal type I-F2 CRISPR-Cas DNA-interference complex. | | Authors: | Mais, C.N., Perry, T.N., Sanchez-Londono, M., Steinchen, W., Innis, C.A., Randau, L., Paush, P., Bange, G. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9g3k | | Status: | HPUB -- hold until publication | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 | | Sequence: | >Entity 1
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
| PDBID: | 9g3l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3w | | Status: | HPUB -- hold until publication | | Title: | Human Gamma-D crystallin R36S mutant with TNB-Cystein Protein modification | | Authors: | Hill, J.A., Pulnova, Y., Yorke, B.A. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq3 | | Status: | HPUB -- hold until publication | | Title: | AkaM,SnoaL-lile Protein | | Authors: | Zhang, B., Ma, X.X., Zhu, A., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq5 | | Status: | HPUB -- hold until publication | | Title: | CatM, SnoaL-like protein | | Authors: | Zhang, B., Zhu, A., Ma, X.X., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqm | | Status: | HPUB -- hold until publication | | Title: | CatM-L6S, a SnoaL-like protein in complex with substrate mimic L6S | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqn | | Status: | HPUB -- hold until publication | | Title: | CatM-W86A-L6R, a SnoaL-like protein in complex with substrate mimic L6R | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9clz | | Status: | HPUB -- hold until publication | | Title: | Novel designed icosahedral nanoparticle I3-A6 | | Authors: | Haas, C.M., Jasti, N., Dosey, A.M., Gillespie, R., Allen, J.D., Leaf, E.M., Crispin, M., DeForest, C., Kanekiyo, M., King, N.P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g2j | | Status: | HPUB -- hold until publication | | Title: | Thaumatin structure determined using SoS chip at ID29 (serial crystallography) | | Authors: | Doak, R.B., Shoeman, R.L., Gorel, A., Barends, T.R.M., Schlichting, I. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipn | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone and incubated shortly | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipo | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipm | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 20-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ipw | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of VHL-EloB-EloC in complex with a fragment compound 7HC_5(D3) | | Authors: | Lee, B.I., Kim, Y. | | Deposition date: | 2024-07-11 | | Release date: | 2025-01-11 |
|
| PDBID: | 9clh | | Status: | HPUB -- hold until publication | | Title: | X-ray diffraction structure of the apo form of papain | | Authors: | Vlahakis, N.W., Rodriguez, J.A. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9clm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Transferrin Binding Protein A in complex with transferrin binding protein B and two molecules of transferrin | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2024-07-11 |
|
| PDBID: | 9ip3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex in a compact conformation from Ebola virus | | Authors: | Li, G., Du, T., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipl | | Status: | HPUB -- hold until publication | | Title: | A tetrapyrrole binding domain variant of CoaR in closed conformation at 2.28 angstrom resolution | | Authors: | Liu, X.C. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip5 | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in brain polar lipid nanodiscs, treated with a 14-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9cl1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | particulate methane monooxygenase in 0.02% DDM | | Authors: | Tucci, F.J., Rosenzweig, A.C. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9cl2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Particulate methane monooxygenase in washed native membranes | | Authors: | Tucci, F.J., Rosenzweig, A.C. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9cl3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Particulate methane monooxygenase in unwashed native membranes | | Authors: | Tucci, F.J., Rosenzweig, A.C. | | Deposition date: | 2024-07-10 |
|
